close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

The Crucible of Flame

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-06-23 Correct Ancient Flame rank 2 upgrade.
Ancient Flame (effect#1) base_value 35.00 25.00
2019-06-23 Correct Ancient Flame base damage.
Ancient Flame (effect#3) coefficient 1.23 2.28

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second39,603 (12.16%)39,301 (11.30%)38,864 (10.06%)38,023 (7.68%)37,586 (6.44%)37,153 (5.22%)36,735 (4.04%)36,706 (3.95%)36,684 (3.89%)36,235 (2.62%)36,024 (2.02%)35,311visionslife-forceconflict+strifelucid dreamsblood of the enemycrucible of flameworldveinfocusing irisunbound forceripple in spacepurification protocolbaseunbound force Damage per Second: 36,684.0

Actions per Minute / DPS Variance Summary

base : 35311 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
35310.5 35310.5 24.8 / 0.070% 4257.5 / 12.1% 4286.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 35311
Heed My Call 291 (416) 0.8% (1.2%) 8.1 33.79sec 15349 0 Direct 8.1 9110 18211 10739 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 87022.60 87022.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.65 82.11% 9109.76 8901 9791 9105.50 0 9791 60615 60615 0.00
crit 1.45 17.89% 18210.65 17802 19582 14127.45 0 19582 26407 26407 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.4% 8.1 33.79sec 4611 0 Direct 8.1 3904 7803 4611 18.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 37365.65 37365.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.64 81.88% 3904.37 3815 4196 3904.34 3815 4196 25908 25908 0.00
crit 1.47 18.12% 7802.98 7629 8392 6049.32 0 8392 11458 11458 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5075 14.4% 77.7 3.77sec 19546 14911 Direct 77.7 16571 33128 19546 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.72 77.72 0.00 0.00 1.3109 0.0000 1519036.32 1519036.32 0.00 14910.64 14910.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.75 82.03% 16570.85 8882 21253 16578.02 15962 17475 1056394 1056394 0.00
crit 13.97 17.97% 33127.52 17765 42507 33138.90 29911 36912 462643 462643 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2456 7.0% 14.0 21.40sec 52315 51658 Direct 14.0 2860 5721 3368 17.8%  
Periodic 221.7 2630 5255 3102 18.0% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.05 14.05 221.67 221.67 1.0128 1.3418 734886.52 734886.52 0.00 2357.90 51657.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 82.22% 2859.69 2589 3565 2861.37 2621 3159 33029 33029 0.00
crit 2.50 17.78% 5720.74 5177 7129 5341.15 0 7129 14288 14288 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.8 82.03% 2630.06 6 3319 2631.33 2551 2750 478230 478230 0.00
crit 39.8 17.97% 5254.87 7 6638 5257.23 4941 5655 209340 209340 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 795 2.3% 44.2 6.61sec 5382 0 Direct 44.2 4565 9122 5382 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.20 44.20 0.00 0.00 0.0000 0.0000 237888.83 237888.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.27 82.06% 4564.52 4180 5756 4566.38 4262 4956 165541 165541 0.00
crit 7.93 17.94% 9122.19 8360 11513 9120.08 0 11513 72348 72348 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2850 (4500) 8.1% (12.8%) 94.2 3.12sec 14287 15797 Direct 94.7 7634 15251 9002 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.24 94.75 0.00 0.00 0.9044 0.0000 852916.19 852916.19 0.00 15797.29 15797.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.73 82.04% 7634.37 6967 9594 7639.10 7386 8052 593445 593445 0.00
crit 17.01 17.96% 15251.30 13933 19188 15258.57 14040 17179 259471 259471 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1649 4.7% 74.8 3.93sec 6596 0 Direct 74.8 6596 0 6596 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.83 74.83 0.00 0.00 0.0000 0.0000 493550.43 493550.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.83 100.00% 6595.62 5086 14007 6599.46 5760 7826 493550 493550 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 11908 33.7% 61.6 4.92sec 57863 54943 Direct 61.4 49253 98355 58048 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.57 61.37 0.00 0.00 1.0531 0.0000 3562637.66 3562637.66 0.00 54943.36 54943.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.38 82.09% 49253.14 45067 61614 49276.02 47419 51668 2481385 2481385 0.00
crit 10.99 17.91% 98355.28 90135 123227 98405.79 90135 119493 1081253 1081253 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1595 4.5% 12.8 23.57sec 37357 36278 Direct 12.8 2424 4841 2859 18.0%  
Periodic 219.3 1704 3406 2010 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 12.78 219.33 219.33 1.0297 1.3445 477310.80 477310.80 0.00 1549.53 36278.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.48 82.04% 2424.49 2231 3073 2425.21 2251 2690 25414 25414 0.00
crit 2.29 17.96% 4841.18 4463 6146 4448.91 0 6146 11110 11110 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.0 82.06% 1704.42 18 2151 1705.24 1656 1779 306742 306742 0.00
crit 39.4 17.94% 3405.84 82 4302 3407.23 3212 3687 134044 134044 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5833 16.4% 90.0 3.10sec 19292 0 Direct 90.0 16351 32707 19291 18.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.01 90.01 0.00 0.00 0.0000 0.0000 1736366.27 1736366.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.83 82.02% 16351.01 15985 17583 16350.90 15985 17289 1207116 1207116 0.00
crit 16.18 17.98% 32707.46 31970 35167 32707.05 31970 34847 529250 529250 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2733 7.7% 17.8 16.78sec 45848 44672 Direct 17.8 3913 7832 4614 17.9%  
Periodic 220.8 2825 5647 3331 18.0% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.84 17.84 220.81 220.81 1.0264 1.3430 817891.42 817891.42 0.00 2597.73 44671.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.65 82.12% 3912.76 3570 4917 3913.31 3615 4237 57317 57317 0.00
crit 3.19 17.88% 7832.23 7141 9834 7575.73 0 9834 24989 24989 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.2 82.05% 2824.66 2 3565 2826.01 2745 2944 511747 511747 0.00
crit 39.6 17.95% 5646.75 61 7129 5649.32 5264 6139 223839 223839 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.64sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.63sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9088 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 54.1 44.0sec 4.9sec 93.16% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.83%
  • arcanic_pulsar_2:10.30%
  • arcanic_pulsar_3:11.33%
  • arcanic_pulsar_4:10.55%
  • arcanic_pulsar_5:13.74%
  • arcanic_pulsar_6:10.57%
  • arcanic_pulsar_7:10.70%
  • arcanic_pulsar_8:14.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.12% 7.56% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 26.00% 32.54% 0.0(0.0) 8.1

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.5sec 23.67% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.28% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.91%
  • ignition_mages_fuse_3:3.86%
  • ignition_mages_fuse_4:3.81%
  • ignition_mages_fuse_5:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.2 46.4 8.9sec 3.7sec 82.43% 99.72% 1.9(1.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.92%
  • lunar_empowerment_2:32.14%
  • lunar_empowerment_3:14.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.4 64.4sec 34.1sec 47.69% 0.00% 3.4(47.3) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.8 52.4 12.0sec 3.9sec 85.83% 79.10% 0.2(0.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.07%
  • solar_empowerment_2:40.00%
  • solar_empowerment_3:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.3 20.2sec 4.9sec 97.83% 92.79% 16.1(16.1) 11.4

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.11%
  • starlord_2:22.62%
  • starlord_3:61.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.6sec 23.64% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.64%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 61.6 2462.8 40.0 40.0 1446.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.24 761.89 (31.42%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.30%) 40.00 0.00 0.00%
sunfire Astral Power 17.84 53.52 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.19 176.77 (7.29%) 4.00 0.00 0.00%
moonfire Astral Power 14.05 42.14 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.78 102.22 (4.22%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.72 932.53 (38.45%) 12.00 0.06 0.01%
natures_balance Astral Power 400.03 200.02 (8.25%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.33 75.95 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.09 8.22
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.58 0.00 58.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data base Damage Per Second
Count 7592
Mean 35310.54
Minimum 31796.74
Maximum 39455.94
Spread ( max - min ) 7659.20
Range [ ( max - min ) / 2 * 100% ] 10.85%
Standard Deviation 1103.9448
5th Percentile 33576.41
95th Percentile 37197.63
( 95th Percentile - 5th Percentile ) 3621.21
Mean Distribution
Standard Deviation 12.6698
95.00% Confidence Intervall ( 35285.71 - 35335.37 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3755
0.1 Scale Factor Error with Delta=300 10404
0.05 Scale Factor Error with Delta=300 41614
0.01 Scale Factor Error with Delta=300 1040348
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 7592
Mean 35310.54
Minimum 31796.74
Maximum 39455.94
Spread ( max - min ) 7659.20
Range [ ( max - min ) / 2 * 100% ] 10.85%
Standard Deviation 1103.9448
5th Percentile 33576.41
95th Percentile 37197.63
( 95th Percentile - 5th Percentile ) 3621.21
Mean Distribution
Standard Deviation 12.6698
95.00% Confidence Intervall ( 35285.71 - 35335.37 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3755
0.1 Scale Factor Error with Delta=300 10404
0.05 Scale Factor Error with Delta=300 41614
0.01 Scale Factor Error with Delta=300 1040348
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 7592
Mean 35310.54
Minimum 31796.74
Maximum 39455.94
Spread ( max - min ) 7659.20
Range [ ( max - min ) / 2 * 100% ] 10.85%
Damage
Sample Data base Damage
Count 7592
Mean 10556872.70
Minimum 8162191.23
Maximum 13247155.43
Spread ( max - min ) 5084964.20
Range [ ( max - min ) / 2 * 100% ] 24.08%
DTPS
Sample Data base Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.90 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 61.57 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.87 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.06 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.75 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 10.99 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 78.08 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.50 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.23 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQPJQPJQPQJQPMQPNQPIJQJOQJKPPPQQPQQJQPQJQPQIJNPPJMOQPPJQPJQPPQJJMNQPJQPOPQQQQJQPIJQJKPNJPPQJQPOPMQJPQJQPNQJPQQQJMPQOJQPJQPGLQPJPQMQQQQIJJPPOQJQPQJNQMPQPQQIJJPPJQPOQJKNQPQQQQJJPPJQPQMHEFJOQJNQPQPQJQPJQPJMQPJQPQJQLOPPJPPJMPQQJPQPQQNOQJJMPPGQJQPQPQQQQJQPQJQJKOPJPPP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.247 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:02.180 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:03.113 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.047 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.860 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.860 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.860 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.617 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.372 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.248 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.003 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.756 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.608 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.362 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.117 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.878 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.632 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.388 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.141 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.896 default M sunfire Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.650 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.406 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.162 default N moonfire Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.918 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.674 default P lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.471 default I cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.471 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.224 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.977 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.731 default O stellar_flare Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.485 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.240 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(23), ignition_mages_fuse(5)
0:23.994 default K sunfire Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), ignition_mages_fuse(5)
0:24.750 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
0:25.617 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21)
0:26.658 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20)
0:27.703 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers
0:28.457 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(18), conch_of_dark_whispers
0:29.284 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:30.340 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:31.173 default Q solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:32.009 default J starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:32.847 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:33.601 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(25), conch_of_dark_whispers
0:34.495 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:35.250 default J starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:36.003 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
0:36.757 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22), conch_of_dark_whispers
0:37.660 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
0:38.414 default I cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
0:38.414 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), overwhelming_power(20), conch_of_dark_whispers
0:39.191 default N moonfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(19), conch_of_dark_whispers
0:40.063 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(18), conch_of_dark_whispers
0:41.178 default P lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(17), conch_of_dark_whispers
0:42.628 default J starsurge Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(16), conch_of_dark_whispers
0:43.771 default M sunfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15)
0:44.887 default O stellar_flare Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(14)
0:46.007 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(12)
0:46.967 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(12)
0:48.403 default P lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
0:49.848 default J starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25)
0:50.924 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24)
0:51.818 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:53.159 default J starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
0:54.219 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
0:55.124 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
0:56.485 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
0:57.853 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(17)
0:58.769 default J starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(25)
0:59.909 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(24)
1:01.022 default M sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22)
1:02.110 default N moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(21)
1:03.200 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(20)
1:04.131 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19)
1:05.531 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18)
1:06.632 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17)
1:07.548 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
1:08.924 default O stellar_flare Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
1:10.009 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
1:11.400 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(12), conch_of_dark_whispers
1:12.332 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
1:13.266 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers
1:14.203 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(9), conch_of_dark_whispers
1:15.311 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers
1:16.424 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers
1:17.248 default P lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers
1:18.490 default I cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(5), conch_of_dark_whispers
1:18.490 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power celestial_alignment, lunar_empowerment, overwhelming_power(5), conch_of_dark_whispers
1:19.554 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(4), conch_of_dark_whispers
1:20.436 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(3), conch_of_dark_whispers
1:21.479 default K sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(2), conch_of_dark_whispers
1:22.496 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power, conch_of_dark_whispers
1:23.993 default N moonfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2)
1:25.171 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2)
1:26.347 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:27.805 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:29.264 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3)
1:30.237 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:31.381 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:32.354 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:33.812 default O stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
1:34.957 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
1:36.415 default M sunfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
1:37.560 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3)
1:38.533 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(4), solar_empowerment, conch_of_dark_whispers
1:39.781 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
1:41.326 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord, conch_of_dark_whispers
1:42.356 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, conch_of_dark_whispers
1:43.568 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:44.571 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
1:45.946 default N moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(23), conch_of_dark_whispers
1:47.030 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
1:47.959 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(21), conch_of_dark_whispers
1:49.048 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
1:50.410 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(18), conch_of_dark_whispers
1:51.323 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
1:52.240 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
1:53.160 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(15)
1:54.245 default M sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14)
1:55.333 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13)
1:56.726 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(12)
1:57.659 default O stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(11)
1:58.760 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), overwhelming_power(10)
1:59.965 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9)
2:00.832 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(8)
2:02.137 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, starlord, overwhelming_power(6), conch_of_dark_whispers
2:03.169 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(5), conch_of_dark_whispers
2:04.023 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(4), conch_of_dark_whispers
2:05.307 default G use_items Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(3), conch_of_dark_whispers
2:05.307 default L moonfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, starlord(2), overwhelming_power(3), conch_of_dark_whispers, ignition_mages_fuse
2:06.278 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, starlord(2), overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse
2:07.401 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse
2:08.836 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse
2:09.967 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.311 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.210 default M sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.265 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.320 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.336 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.354 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.372 default I cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
2:17.372 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.441 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(4)
2:19.476 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(4)
2:20.667 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(4)
2:21.864 default O stellar_flare Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(5)
2:22.776 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), overwhelming_power(21), ignition_mages_fuse(5)
2:23.550 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(20), ignition_mages_fuse(5)
2:24.465 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19), ignition_mages_fuse(5)
2:25.225 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), ignition_mages_fuse(5)
2:26.365 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(17)
2:27.282 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(16)
2:28.364 default N moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
2:29.448 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
2:30.373 default M sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
2:31.467 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
2:32.863 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(11)
2:33.798 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10)
2:35.204 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(8)
2:36.149 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(7)
2:37.098 default I cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(6)
2:37.098 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(6), overwhelming_power(6)
2:38.318 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5)
2:39.507 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4)
2:40.984 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(3)
2:42.467 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power
2:43.641 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
2:44.488 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
2:45.757 default O stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:46.756 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:47.604 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power celestial_alignment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:48.601 default K sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:49.598 default N moonfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:50.745 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:51.718 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:53.178 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:54.151 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers
2:55.125 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar, starlord(3), conch_of_dark_whispers
2:56.270 default Q solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar, starlord(3), overwhelming_power(25), conch_of_dark_whispers
2:57.318 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar, overwhelming_power(24), conch_of_dark_whispers
2:58.462 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), conch_of_dark_whispers
2:59.577 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers
3:00.962 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21)
3:02.352 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(19)
3:03.453 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18)
3:04.366 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
3:05.737 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(16)
3:06.654 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(15)
3:07.738 default H celestial_alignment Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(14)
3:08.687 default E potion Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(13)
3:08.687 default F berserking Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:08.687 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, arcanic_pulsar(4), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:09.551 default O stellar_flare Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:10.419 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:11.176 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:12.051 default N moonfire Fluffy_Pillow 21.0/100: 21% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:12.927 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:13.682 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:14.804 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:15.559 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:16.687 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:17.445 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), overwhelming_power(4), battle_potion_of_intellect
3:18.420 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(3), battle_potion_of_intellect
3:19.227 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(2), battle_potion_of_intellect
3:20.437 default J starsurge Fluffy_Pillow 65.5/100: 66% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power, battle_potion_of_intellect
3:21.393 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:22.265 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect
3:23.573 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:24.597 default M sunfire Fluffy_Pillow 20.0/100: 20% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:25.593 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:26.441 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:27.709 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:28.705 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:29.553 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:30.824 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:31.672 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect
3:32.668 default Q solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:33.515 default L moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect
3:34.510 default O stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3)
3:35.654 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3)
3:37.114 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
3:38.575 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, torrent_of_elements
3:39.824 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements
3:41.368 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:42.912 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements
3:44.123 default M sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:45.301 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:46.801 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), torrent_of_elements
3:47.803 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements
3:48.805 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements
3:49.984 default P lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:51.445 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
3:52.417 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
3:53.878 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
3:54.852 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
3:55.997 default N moonfire Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
3:57.142 default O stellar_flare Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
3:58.288 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
3:59.433 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(5), conch_of_dark_whispers
4:00.680 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
4:01.894 default M sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:03.072 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:04.572 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:06.073 default G use_items Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), conch_of_dark_whispers
4:06.073 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
4:07.034 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
4:08.165 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse
4:09.100 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
4:10.500 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(2)
4:11.329 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(2)
4:12.574 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(2)
4:13.409 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(2)
4:14.392 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(3)
4:15.344 default Q solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(3)
4:16.300 default J starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(3)
4:17.259 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), ignition_mages_fuse(3)
4:18.013 default P lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), ignition_mages_fuse(3)
4:19.083 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), ignition_mages_fuse(4)
4:19.896 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(4)
4:20.757 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(4)
4:21.512 default J starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(4)
4:22.352 default K sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(5)
4:23.145 default O stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(5)
4:24.058 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(5)
4:25.224 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(5)
4:26.141 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
4:27.508 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
4:28.879 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

blood of the enemy : 37586 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
37585.6 37585.6 29.1 / 0.077% 5004.1 / 13.3% 4576.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 37586
Blood of the Enemy 362 1.0% 3.7 91.20sec 29499 30710 Direct 3.7 22903 57336 29503 19.2%  

Stats details: blood_of_the_enemy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 3.68 0.00 0.00 0.9606 0.0000 108436.94 108436.94 0.00 30709.98 30709.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.97 80.84% 22902.91 22467 24714 22824.38 0 24714 68063 68063 0.00
crit 0.70 19.16% 57335.79 56168 61785 31012.09 0 61785 40373 40373 0.00
 
 

Action details: blood_of_the_enemy

Static Values
  • id:297108
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.ca_inc.remains>30
Spelldata
  • id:297108
  • name:Blood of the Enemy
  • school:shadow
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing {$s1=5936} Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20460.77
  • base_dd_max:20460.77
  • base_dd_mult:1.00
 
Heed My Call 309 (442) 0.8% (1.2%) 8.2 33.29sec 16074 0 Direct 8.2 9107 18713 11243 22.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 92576.76 92576.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.40 77.75% 9106.55 8901 9791 9102.90 0 9791 58301 58301 0.00
crit 1.83 22.25% 18712.67 17802 24477 15856.44 0 24477 34276 34276 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 133 0.4% 8.2 33.29sec 4830 0 Direct 8.2 3903 8019 4830 22.5%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 39768.91 39768.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.38 77.48% 3903.13 3815 4196 3902.09 0 4196 24901 24901 0.00
crit 1.85 22.52% 8019.29 7629 10490 6839.99 0 10490 14868 14868 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5233 13.9% 77.3 3.79sec 20273 15600 Direct 77.3 16497 33961 20273 21.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.26 77.26 0.00 0.00 1.2996 0.0000 1566207.98 1566207.98 0.00 15599.84 15599.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.55 78.38% 16496.59 8882 21253 16502.97 15869 17288 998869 998869 0.00
crit 16.71 21.62% 33961.23 17765 53133 33994.68 30866 39714 567339 567339 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2607 6.9% 14.0 21.41sec 55513 55075 Direct 14.0 2848 5920 3514 21.7%  
Periodic 223.7 2616 5514 3264 22.4% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.05 14.05 223.74 223.74 1.0080 1.3294 779691.86 779691.86 0.00 2502.28 55074.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.00 78.33% 2848.19 2589 3565 2849.24 2643 3194 31337 31337 0.00
crit 3.04 21.67% 5920.02 5177 8912 5747.43 0 8912 18014 18014 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.7 77.63% 2616.16 2 3319 2617.30 2546 2734 454418 454418 0.00
crit 50.0 22.37% 5513.97 12 8297 5518.80 5148 6085 275923 275923 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 845 2.3% 44.7 6.54sec 5656 0 Direct 44.7 4541 9552 5656 22.3%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.72 44.72 0.00 0.00 0.0000 0.0000 252948.08 252948.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.76 77.74% 4540.55 4180 5756 4542.61 4283 4892 157843 157843 0.00
crit 9.96 22.26% 9552.03 8360 14391 9559.88 0 14391 95105 95105 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2957 (4679) 7.9% (12.5%) 93.7 3.13sec 14935 16630 Direct 94.2 7587 15695 9387 22.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.73 94.24 0.00 0.00 0.8981 0.0000 884621.36 884621.36 0.00 16629.51 16629.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.32 77.81% 7587.46 6967 9594 7591.41 7331 7977 556348 556348 0.00
crit 20.92 22.19% 15694.51 13933 23984 15708.55 14325 17857 328273 328273 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1722 4.6% 74.4 3.93sec 6924 0 Direct 74.4 6924 0 6924 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.40 74.40 0.00 0.00 0.0000 0.0000 515200.53 515200.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.40 100.00% 6924.36 5086 17509 6930.23 5823 8117 515201 515201 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 12565 33.4% 61.4 4.92sec 61227 58627 Direct 61.2 48956 103812 61424 22.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.36 61.17 0.00 0.00 1.0444 0.0000 3757177.92 3757177.92 0.00 58627.12 58627.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.27 77.27% 48955.55 45067 61614 48974.59 46999 51840 2313885 2313885 0.00
crit 13.90 22.73% 103811.58 90135 154034 104000.37 91036 121336 1443293 1443293 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1695 4.5% 12.8 23.58sec 39672 38708 Direct 12.8 2409 5122 3008 22.1%  
Periodic 221.4 1696 3574 2117 22.4% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 12.78 221.40 221.40 1.0250 1.3318 507074.05 507074.05 0.00 1646.48 38707.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.96 77.94% 2409.11 2231 3073 2409.04 2231 2622 24000 24000 0.00
crit 2.82 22.06% 5121.54 4463 7683 4959.39 0 7683 14440 14440 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.8 77.59% 1695.77 12 2151 1696.52 1639 1768 291302 291302 0.00
crit 49.6 22.41% 3573.55 31 5378 3577.08 3322 3928 177331 177331 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6263 16.6% 88.7 3.14sec 21011 0 Direct 88.7 16354 34124 21012 26.2%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.69 88.69 0.00 0.00 0.0000 0.0000 1863541.48 1863541.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.45 73.79% 16353.74 15985 17583 16353.87 15985 17210 1070289 1070289 0.00
crit 23.25 26.21% 34124.09 31970 43958 34135.25 31970 38230 793253 793253 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2894 7.7% 17.8 16.76sec 48520 47679 Direct 17.8 3902 8038 4777 21.2%  
Periodic 222.9 2811 5908 3501 22.3% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.84 17.84 222.91 222.91 1.0177 1.3304 865711.13 865711.13 0.00 2750.87 47679.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.07 78.83% 3901.84 3570 4917 3902.01 3648 4188 54881 54881 0.00
crit 3.78 21.17% 8037.78 7141 12292 7911.43 0 12292 30358 30358 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.2 77.71% 2810.83 3 3565 2812.05 2724 2938 486880 486880 0.00
crit 49.7 22.29% 5908.03 22 8912 5913.81 5532 6465 293592 293592 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.53sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.72sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9033 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 54.0 44.2sec 4.9sec 93.29% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.68%
  • arcanic_pulsar_2:10.25%
  • arcanic_pulsar_3:11.64%
  • arcanic_pulsar_4:10.82%
  • arcanic_pulsar_5:13.55%
  • arcanic_pulsar_6:10.32%
  • arcanic_pulsar_7:10.61%
  • arcanic_pulsar_8:14.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.70% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 5.2 0.0 57.7sec 57.7sec 13.74% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:592.56

Stack Uptimes

  • bloodsoaked_1:13.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 4.8 207.9 65.8sec 1.4sec 86.94% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.09

Stack Uptimes

  • bloodsoaked_counter_1:2.49%
  • bloodsoaked_counter_2:2.27%
  • bloodsoaked_counter_3:2.12%
  • bloodsoaked_counter_4:2.03%
  • bloodsoaked_counter_5:2.04%
  • bloodsoaked_counter_6:1.99%
  • bloodsoaked_counter_7:1.95%
  • bloodsoaked_counter_8:1.94%
  • bloodsoaked_counter_9:1.92%
  • bloodsoaked_counter_10:5.92%
  • bloodsoaked_counter_11:2.42%
  • bloodsoaked_counter_12:2.46%
  • bloodsoaked_counter_13:2.45%
  • bloodsoaked_counter_14:2.38%
  • bloodsoaked_counter_15:2.35%
  • bloodsoaked_counter_16:2.35%
  • bloodsoaked_counter_17:2.32%
  • bloodsoaked_counter_18:2.27%
  • bloodsoaked_counter_19:2.23%
  • bloodsoaked_counter_20:2.23%
  • bloodsoaked_counter_21:2.20%
  • bloodsoaked_counter_22:2.19%
  • bloodsoaked_counter_23:2.13%
  • bloodsoaked_counter_24:2.11%
  • bloodsoaked_counter_25:2.14%
  • bloodsoaked_counter_26:2.09%
  • bloodsoaked_counter_27:2.08%
  • bloodsoaked_counter_28:2.07%
  • bloodsoaked_counter_29:2.06%
  • bloodsoaked_counter_30:2.02%
  • bloodsoaked_counter_31:2.04%
  • bloodsoaked_counter_32:2.00%
  • bloodsoaked_counter_33:2.01%
  • bloodsoaked_counter_34:1.99%
  • bloodsoaked_counter_35:1.96%
  • bloodsoaked_counter_36:1.96%
  • bloodsoaked_counter_37:1.92%
  • bloodsoaked_counter_38:1.92%
  • bloodsoaked_counter_39:1.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 25.96% 32.36% 0.0(0.0) 8.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.7sec 23.65% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.28% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.91%
  • ignition_mages_fuse_3:3.86%
  • ignition_mages_fuse_4:3.81%
  • ignition_mages_fuse_5:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.0 46.3 8.9sec 3.7sec 82.15% 99.81% 1.9(1.9) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.81%
  • lunar_empowerment_2:31.83%
  • lunar_empowerment_3:14.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.0sec 33.6sec 48.30% 0.00% 3.5(48.8) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.06%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.18%
  • overwhelming_power_18:2.25%
  • overwhelming_power_19:2.32%
  • overwhelming_power_20:2.39%
  • overwhelming_power_21:2.46%
  • overwhelming_power_22:2.54%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Seething Rage 3.7 0.0 91.2sec 91.2sec 6.10% 0.00% 0.0(0.0) 3.6

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_seething_rage
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • seething_rage_1:6.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297126
  • name:Seething Rage
  • tooltip:Critical strike damage increased by $w1%.
  • description:{$@spelldesc297122=Increases your critical hit damage by $297126m% for {$297126d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.8 51.9 12.0sec 3.9sec 85.98% 79.06% 0.3(0.3) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.48%
  • solar_empowerment_2:39.83%
  • solar_empowerment_3:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.1 20.2sec 4.9sec 97.80% 93.03% 15.8(15.8) 11.5

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.60%
  • starlord_2:22.49%
  • starlord_3:60.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.4sec 23.66% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.66%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 61.4 2454.6 40.0 40.0 1530.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 94.73 757.76 (31.35%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.31%) 40.00 0.00 0.00%
sunfire Astral Power 17.84 53.53 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.72 178.87 (7.40%) 4.00 0.01 0.01%
moonfire Astral Power 14.05 42.14 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.78 102.25 (4.23%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.26 927.00 (38.35%) 12.00 0.06 0.01%
natures_balance Astral Power 400.03 200.01 (8.27%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.31 75.67 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.07 8.19
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.89 0.00 83.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data blood of the enemy Damage Per Second
Count 7592
Mean 37585.65
Minimum 33465.98
Maximum 42876.92
Spread ( max - min ) 9410.94
Range [ ( max - min ) / 2 * 100% ] 12.52%
Standard Deviation 1293.9732
5th Percentile 35535.42
95th Percentile 39735.79
( 95th Percentile - 5th Percentile ) 4200.37
Mean Distribution
Standard Deviation 14.8507
95.00% Confidence Intervall ( 37556.54 - 37614.76 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4554
0.1 Scale Factor Error with Delta=300 14294
0.05 Scale Factor Error with Delta=300 57174
0.01 Scale Factor Error with Delta=300 1429336
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 7592
Mean 37585.65
Minimum 33465.98
Maximum 42876.92
Spread ( max - min ) 9410.94
Range [ ( max - min ) / 2 * 100% ] 12.52%
Standard Deviation 1293.9732
5th Percentile 35535.42
95th Percentile 39735.79
( 95th Percentile - 5th Percentile ) 4200.37
Mean Distribution
Standard Deviation 14.8507
95.00% Confidence Intervall ( 37556.54 - 37614.76 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4554
0.1 Scale Factor Error with Delta=300 14294
0.05 Scale Factor Error with Delta=300 57174
0.01 Scale Factor Error with Delta=300 1429336
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 7592
Mean 37585.65
Minimum 33465.98
Maximum 42876.92
Spread ( max - min ) 9410.94
Range [ ( max - min ) / 2 * 100% ] 12.52%
Damage
Sample Data blood of the enemy Damage
Count 7592
Mean 11232957.00
Minimum 8822514.84
Maximum 13921857.72
Spread ( max - min ) 5099342.89
Range [ ( max - min ) / 2 * 100% ] 22.70%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
H 3.68 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.90 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.36 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.84 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 3.01 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.74 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.04 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.62 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 93.98 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.26 sunfire

Sample Sequence

0123456789ACDKONPIFGHKRKRQRKRQRKRNRQORQRKPKRQLQKRQQRRQRRKRKRQRQRMKKNQPQKRQKRQQRRRRQKKNOQQKPRQRQRRNRJKRKRKRMQKQQPKHNQQRKRQOQRKRQRKNQPQRQKKGRQRQRKORNQKRQQRRRPRKKQQKORNQQRKRQRRRRKKPQNQKORQKRLQQQRRKQIEFHKPKRQORKNRQKRQRQRQKLQKRQRKPRQKRQORQRNKQKRQRKQRRQKOPQNRGKQRQKRQKRQQRRRONPRJKRKRKRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.181 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.113 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:04.047 default I celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.859 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.859 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.859 default H blood_of_the_enemy Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:05.612 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.367 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(5), battle_potion_of_intellect, ignition_mages_fuse
0:07.121 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(8), battle_potion_of_intellect, ignition_mages_fuse
0:07.875 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.629 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(13), battle_potion_of_intellect, ignition_mages_fuse
0:09.482 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(16), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.237 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(19), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.992 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.747 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.566 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.320 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(29), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.075 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.831 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(32), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.587 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(33), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.341 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(34), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.128 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(34), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.883 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(36), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.638 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(38), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.475 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.231 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(23), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.986 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.740 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.494 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.248 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), bloodsoaked, ignition_mages_fuse(5)
0:24.003 default L sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), bloodsoaked, ignition_mages_fuse(5)
0:24.757 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), bloodsoaked, ignition_mages_fuse(5)
0:25.612 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), bloodsoaked
0:26.407 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), bloodsoaked
0:27.160 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked
0:28.151 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
0:29.217 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter
0:29.973 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(14), bloodsoaked_counter(2)
0:30.726 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked_counter(3)
0:31.798 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(12), bloodsoaked_counter(3)
0:32.643 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(11), bloodsoaked_counter(4)
0:33.492 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(10), bloodsoaked_counter(4)
0:34.343 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked_counter(4)
0:35.099 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked_counter(5)
0:35.854 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked_counter(6)
0:36.609 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), bloodsoaked_counter(6)
0:37.562 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(6), bloodsoaked_counter(7)
0:38.318 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(9)
0:39.209 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter(10)
0:39.964 default M moonfire Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter(11)
0:40.718 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, overwhelming_power(23), bloodsoaked_counter(11)
0:41.602 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(12)
0:42.722 default N sunfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21), bloodsoaked_counter(12)
0:43.813 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(20), bloodsoaked_counter(13)
0:45.209 default P stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(13)
0:46.312 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(14)
0:47.722 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(14)
0:48.833 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(14)
0:49.756 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(15)
0:51.144 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(16)
0:52.240 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(16)
0:53.175 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), bloodsoaked_counter(16)
0:54.582 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(16)
0:55.993 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(17)
0:56.937 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(17)
0:57.886 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(17)
0:58.839 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(18)
0:59.965 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(4), bloodsoaked_counter(19)
1:01.403 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(5), overwhelming_power(2), bloodsoaked_counter(20)
1:02.643 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power, bloodsoaked_counter(20)
1:03.851 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(20)
1:05.027 default O moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(22)
1:06.204 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(22)
1:07.705 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(22)
1:09.205 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(24)
1:10.383 default P stellar_flare Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(24)
1:11.528 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(24)
1:12.501 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(25)
1:13.962 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(25)
1:14.937 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(25)
1:16.395 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(27)
1:17.369 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(28)
1:18.514 default N sunfire Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(29)
1:19.659 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(31)
1:20.804 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, bloodsoaked_counter(32)
1:20.804 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), torrent_of_elements, bloodsoaked_counter(32)
1:22.053 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(33)
1:22.950 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(35)
1:24.004 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(36)
1:24.875 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(37)
1:25.899 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(37)
1:26.746 default M moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(37)
1:27.743 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(38)
1:29.203 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(39)
1:30.349 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked
1:31.709 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked
1:33.068 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked
1:34.136 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked
1:35.205 default H blood_of_the_enemy Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked
1:36.274 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked
1:37.343 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(10), bloodsoaked
1:38.704 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(11)
1:40.163 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power seething_rage, arcanic_pulsar(4), solar_empowerment(3), starlord(3), bloodsoaked_counter(11)
1:41.136 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), bloodsoaked_counter(11)
1:42.385 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord, bloodsoaked_counter(11)
1:43.413 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, bloodsoaked_counter(13)
1:44.957 default O moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(16)
1:46.171 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(16)
1:47.714 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord, bloodsoaked_counter(17)
1:48.743 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, bloodsoaked_counter(17)
1:49.955 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), bloodsoaked_counter(17)
1:50.954 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(17)
1:52.455 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), bloodsoaked_counter(17)
1:53.457 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(17)
1:54.634 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(20)
1:55.777 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(20)
1:57.236 default P stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(20)
1:58.381 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(21)
1:59.842 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), bloodsoaked_counter(22)
2:00.816 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(22)
2:02.275 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(7), solar_empowerment, bloodsoaked_counter(23)
2:03.523 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(27)
2:04.735 default G use_items Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(27)
2:04.735 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(27), ignition_mages_fuse
2:05.573 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(28), ignition_mages_fuse
2:06.825 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(29), ignition_mages_fuse
2:07.663 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(29), ignition_mages_fuse
2:08.915 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), bloodsoaked_counter(29), ignition_mages_fuse(2)
2:09.718 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(30), ignition_mages_fuse(2)
2:10.664 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(30), ignition_mages_fuse(2)
2:11.719 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(32), ignition_mages_fuse(2)
2:12.618 default N sunfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(32), ignition_mages_fuse(2)
2:13.676 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(33), ignition_mages_fuse(3)
2:14.872 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked_counter(34), ignition_mages_fuse(3)
2:15.812 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), bloodsoaked_counter(34), ignition_mages_fuse(3)
2:16.611 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(34), ignition_mages_fuse(3)
2:17.813 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(34), ignition_mages_fuse(4)
2:18.978 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(21), bloodsoaked_counter(36), ignition_mages_fuse(4)
2:19.758 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(36), ignition_mages_fuse(4)
2:20.541 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(36), ignition_mages_fuse(4)
2:21.329 default P stellar_flare Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(36), ignition_mages_fuse(5)
2:22.224 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(17), bloodsoaked_counter(36), ignition_mages_fuse(5)
2:23.122 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(16), bloodsoaked_counter(39), ignition_mages_fuse(5)
2:24.103 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(15), bloodsoaked_counter(39), ignition_mages_fuse(5)
2:25.059 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(14), bloodsoaked_counter(39)
2:26.484 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), bloodsoaked
2:27.822 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(12), bloodsoaked
2:28.878 default O moonfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), bloodsoaked
2:29.907 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), bloodsoaked
2:30.784 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked
2:31.819 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8), bloodsoaked
2:33.145 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), bloodsoaked
2:34.477 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(5), bloodsoaked_counter
2:35.433 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(4), bloodsoaked_counter(3)
2:36.562 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), bloodsoaked_counter(4)
2:37.525 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), bloodsoaked_counter(4)
2:38.974 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power, bloodsoaked_counter(5)
2:39.944 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), bloodsoaked_counter(5)
2:40.918 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), starlord(3), bloodsoaked_counter(5)
2:42.062 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), starlord(3), bloodsoaked_counter(6)
2:43.206 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(6), bloodsoaked_counter(7)
2:44.456 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(8)
2:45.668 default P stellar_flare Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(8)
2:46.845 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(9)
2:48.346 default N sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(10)
2:49.523 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(10)
2:51.023 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(11)
2:52.201 default O moonfire Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(12), conch_of_dark_whispers
2:53.196 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(13), conch_of_dark_whispers
2:54.042 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(14), conch_of_dark_whispers
2:55.311 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(16), conch_of_dark_whispers
2:56.307 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(17), conch_of_dark_whispers
2:57.155 default L sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(17), conch_of_dark_whispers
2:58.152 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(19), conch_of_dark_whispers
2:59.490 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(21), conch_of_dark_whispers
3:00.833 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(22), conch_of_dark_whispers
3:02.182 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(24), conch_of_dark_whispers
3:03.087 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(25), conch_of_dark_whispers
3:03.997 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(25), bloodsoaked_counter(25), conch_of_dark_whispers
3:05.137 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(26), conch_of_dark_whispers
3:06.558 default I celestial_alignment Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(27), conch_of_dark_whispers
3:07.531 default E potion Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(27)
3:07.531 default F berserking Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(27), battle_potion_of_intellect
3:07.531 default H blood_of_the_enemy Fluffy_Pillow 90.0/100: 90% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(27), battle_potion_of_intellect
3:08.419 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(27), battle_potion_of_intellect
3:09.311 default P stellar_flare Fluffy_Pillow 51.0/100: 51% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(30), battle_potion_of_intellect
3:10.181 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(34), battle_potion_of_intellect
3:11.054 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(36), battle_potion_of_intellect
3:11.808 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(36), battle_potion_of_intellect
3:12.893 default O moonfire Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(39), conch_of_dark_whispers, battle_potion_of_intellect
3:13.748 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:14.503 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:15.307 default N sunfire Fluffy_Pillow 14.0/100: 14% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:16.116 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:16.871 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:17.904 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:18.721 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:19.475 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:20.519 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:21.286 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:22.521 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter, conch_of_dark_whispers, battle_potion_of_intellect
3:23.436 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked_counter(5), conch_of_dark_whispers, battle_potion_of_intellect
3:24.601 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(6), celestial_alignment, overwhelming_power(22), bloodsoaked_counter(6), conch_of_dark_whispers, battle_potion_of_intellect
3:25.605 default L sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), bloodsoaked_counter(7), conch_of_dark_whispers, battle_potion_of_intellect
3:26.584 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), bloodsoaked_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:28.020 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, overwhelming_power(18), bloodsoaked_counter(9), battle_potion_of_intellect
3:29.156 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(17), bloodsoaked_counter(9), battle_potion_of_intellect
3:30.097 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), bloodsoaked_counter(9), battle_potion_of_intellect
3:31.472 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(23), bloodsoaked_counter(10), battle_potion_of_intellect
3:32.392 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(10), battle_potion_of_intellect
3:33.480 default P stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), bloodsoaked_counter(10)
3:34.402 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), bloodsoaked_counter(11)
3:35.189 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked_counter(11)
3:36.374 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(12)
3:37.308 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17), bloodsoaked_counter(13)
3:38.104 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(13)
3:39.300 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked_counter(13)
3:40.384 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter(13)
3:41.309 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked_counter(13)
3:42.700 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(14), conch_of_dark_whispers
3:43.633 default N sunfire Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, starlord(3), overwhelming_power(11), bloodsoaked_counter(14), conch_of_dark_whispers
3:44.734 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar, overwhelming_power(10), bloodsoaked_counter(15), conch_of_dark_whispers
3:45.937 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9), bloodsoaked_counter(17), conch_of_dark_whispers
3:47.431 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, overwhelming_power(7), bloodsoaked_counter(19), conch_of_dark_whispers
3:48.611 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(6), bloodsoaked_counter(20), conch_of_dark_whispers
3:49.589 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), bloodsoaked_counter(20), conch_of_dark_whispers
3:51.061 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(3), bloodsoaked_counter(21), conch_of_dark_whispers
3:52.049 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(2), bloodsoaked_counter(22), conch_of_dark_whispers
3:53.217 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, bloodsoaked_counter(23), conch_of_dark_whispers
3:54.670 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), bloodsoaked_counter(23), conch_of_dark_whispers
3:55.645 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), bloodsoaked_counter(23), conch_of_dark_whispers
3:56.618 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), bloodsoaked_counter(26), conch_of_dark_whispers
3:58.078 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), starlord(3), bloodsoaked_counter(26)
3:59.224 default O moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(30)
4:00.369 default P stellar_flare Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(31)
4:01.515 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(32)
4:02.973 default N sunfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), bloodsoaked_counter(33)
4:04.020 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(33)
4:04.917 default G use_items Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(35)
4:04.917 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(35), ignition_mages_fuse
4:06.021 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(35), ignition_mages_fuse
4:07.398 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(35), ignition_mages_fuse
4:08.319 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(35), ignition_mages_fuse
4:09.704 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(36), ignition_mages_fuse(2)
4:10.757 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(37), ignition_mages_fuse(2)
4:11.627 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(37), ignition_mages_fuse(2)
4:12.937 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(39), ignition_mages_fuse(3)
4:13.933 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), bloodsoaked, ignition_mages_fuse(3)
4:14.712 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked, ignition_mages_fuse(3)
4:15.882 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked, ignition_mages_fuse(3)
4:17.054 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked, ignition_mages_fuse(4)
4:17.818 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), bloodsoaked, ignition_mages_fuse(4)
4:18.581 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(9), bloodsoaked, ignition_mages_fuse(4)
4:19.480 default O moonfire Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(8), bloodsoaked, ignition_mages_fuse(4)
4:20.382 default N sunfire Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(7), bloodsoaked, ignition_mages_fuse(4)
4:21.288 default P stellar_flare Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6), bloodsoaked, ignition_mages_fuse(5)
4:22.166 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(5), bloodsoaked_counter(2), ignition_mages_fuse(5)
4:23.097 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(4), bloodsoaked_counter(2), ignition_mages_fuse(5)
4:23.097 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(8), overwhelming_power(4), bloodsoaked_counter(2), ignition_mages_fuse(5)
4:24.115 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(3), bloodsoaked_counter(2), ignition_mages_fuse(5)
4:24.870 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(3), bloodsoaked_counter(3), ignition_mages_fuse(5)
4:25.732 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(2), bloodsoaked_counter(3)
4:26.598 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power, bloodsoaked_counter(5)
4:27.619 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(5)
4:28.468 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(6)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

conflict+strife : 38864 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
38864.4 38864.4 30.1 / 0.077% 5029.8 / 12.9% 4774.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.2 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
conflict+strife 38864
Heed My Call 303 (432) 0.8% (1.1%) 8.1 33.31sec 15938 0 Direct 8.1 9451 18919 11160 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.12 8.12 0.00 0.00 0.0000 0.0000 90631.33 90631.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.65 81.95% 9451.12 8901 10236 9452.60 0 10236 62895 62895 0.00
crit 1.47 18.05% 18919.28 17802 20472 14659.94 0 20472 27736 27736 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.1 33.31sec 4778 0 Direct 8.1 4051 8108 4778 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.12 8.12 0.00 0.00 0.0000 0.0000 38797.35 38797.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.67 82.08% 4050.54 3815 4387 4050.54 0 4387 27000 27000 0.00
crit 1.46 17.92% 8107.72 7629 8774 6278.13 0 8774 11798 11798 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5185 13.4% 76.5 3.82sec 20291 15488 Direct 76.5 17224 34417 20291 17.8%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.51 76.51 0.00 0.00 1.3101 0.0000 1552359.54 1552359.54 0.00 15488.28 15488.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.86 82.16% 17223.78 8932 22219 17230.38 16579 18206 1082643 1082643 0.00
crit 13.65 17.84% 34416.86 18067 44438 34424.67 29263 40291 469716 469716 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2538 6.5% 14.1 21.32sec 54044 53062 Direct 14.1 2960 5925 3498 18.1%  
Periodic 220.9 2727 5450 3217 18.0% 99.0%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.05 14.05 220.85 220.85 1.0185 1.3430 759527.97 759527.97 0.00 2442.94 53061.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.51 81.87% 2959.91 2589 3727 2961.59 2714 3245 34055 34055 0.00
crit 2.55 18.13% 5924.53 5177 7453 5543.21 0 7453 15099 15099 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 82.02% 2726.96 2 3470 2728.07 2643 2847 493973 493973 0.00
crit 39.7 17.98% 5449.95 13 6939 5451.87 5098 5916 216401 216401 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 823 2.1% 44.1 6.63sec 5590 0 Direct 44.1 4733 9461 5590 18.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.07 44.07 0.00 0.00 0.0000 0.0000 246357.34 246357.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.08 81.87% 4732.85 4180 6018 4734.56 4423 5135 170750 170750 0.00
crit 7.99 18.13% 9460.51 8360 12036 9464.52 8407 12036 75607 75607 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2905 (4594) 7.5% (11.8%) 92.5 3.18sec 14868 16460 Direct 93.0 7923 15841 9351 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.49 93.00 0.00 0.00 0.9033 0.0000 869570.81 869570.81 0.00 16460.08 16460.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.23 81.97% 7922.86 6967 10030 7927.22 7645 8409 603943 603943 0.00
crit 16.77 18.03% 15841.10 13933 20060 15849.69 14487 18118 265628 265628 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1689 4.4% 73.8 3.97sec 6855 0 Direct 73.8 6855 0 6855 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.75 73.75 0.00 0.00 0.0000 0.0000 505569.95 505569.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.75 100.00% 6854.74 5086 14644 6857.51 6005 8135 505570 505570 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5316.74
  • base_dd_max:5316.74
  • base_dd_mult:1.00
 
Starsurge 12211 31.5% 60.8 4.96sec 60090 56968 Direct 60.6 51110 102177 60274 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.81 60.62 0.00 0.00 1.0548 0.0000 3653806.05 3653806.05 0.00 56967.88 56967.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.74 82.06% 51109.53 45067 64414 51131.64 49255 53422 2542338 2542338 0.00
crit 10.88 17.94% 102177.18 90135 128828 102203.11 0 116902 1111468 1111468 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1647 4.2% 12.7 23.57sec 38687 37306 Direct 12.7 2493 4981 2940 17.9%  
Periodic 218.5 1768 3534 2084 17.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 218.49 218.49 1.0371 1.3458 492855.57 492855.57 0.00 1604.07 37306.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.45 82.06% 2493.09 2231 3213 2493.65 2334 2714 26062 26062 0.00
crit 2.29 17.94% 4981.33 4463 6425 4561.56 0 6425 11386 11386 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.3 82.07% 1767.74 12 2249 1768.48 1716 1853 316988 316988 0.00
crit 39.2 17.93% 3533.76 15 4498 3535.01 3279 3784 138420 138420 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5956 15.3% 88.9 3.13sec 19936 0 Direct 88.9 16901 33814 19936 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.93 88.93 0.00 0.00 0.0000 0.0000 1772885.48 1772885.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.97 82.06% 16900.88 15985 18383 16900.08 16286 17880 1233302 1233302 0.00
crit 15.96 17.94% 33813.74 31970 36765 33813.51 32259 36340 539583 539583 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2822 7.3% 17.8 16.79sec 47553 46343 Direct 17.8 4054 8121 4785 18.0%  
Periodic 220.0 2929 5855 3453 17.9% 98.7%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.76 17.76 220.02 220.02 1.0262 1.3439 844693.13 844693.13 0.00 2690.83 46342.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.57 82.01% 4053.62 3570 5140 4054.22 3764 4479 59051 59051 0.00
crit 3.20 17.99% 8120.99 7141 10281 7860.57 0 10281 25951 25951 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.7 82.11% 2929.34 5 3727 2930.55 2845 3052 529197 529197 0.00
crit 39.4 17.89% 5854.66 7 7453 5856.60 5540 6320 230494 230494 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Thorns 2656 6.8% 45.0 4.47sec 17451 201836 Direct 40.0 16698 33389 19631 17.6%  

Stats details: thorns

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.00 40.00 0.00 0.00 0.0865 0.0000 785343.76 785343.76 0.00 201835.97 201835.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.97 82.42% 16698.11 15447 19338 16698.36 16059 17733 550572 550572 0.00
crit 7.03 17.58% 33389.36 30894 38677 33370.97 0 38677 234772 234772 0.00
 
 

Action details: thorns

Static Values
  • id:305497
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:3600.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:305497
  • name:Thorns
  • school:nature
  • tooltip:Melee attackers take Nature damage when hit and their movement speed is slowed by {$232559s1=50}% for {$232559d=4 seconds}.
  • description:Sprout thorns for {$d=12 seconds} on the friendly target. When victim to melee attacks, thorns deals {$305496s1=0} Nature damage back to the attacker. Attackers also have their movement speed reduced by {$232559s1=50}% for {$232559d=4 seconds}.
 
Simple Action Stats Execute Interval
conflict+strife
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.38sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.35sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9002 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:conflict+strife
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.5 44.5sec 5.0sec 93.09% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.35%
  • arcanic_pulsar_2:10.67%
  • arcanic_pulsar_3:11.71%
  • arcanic_pulsar_4:10.45%
  • arcanic_pulsar_5:13.61%
  • arcanic_pulsar_6:10.02%
  • arcanic_pulsar_7:10.72%
  • arcanic_pulsar_8:14.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.3sec 182.3sec 8.12% 7.83% 0.0(0.0) 2.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.85% 32.51% 0.0(0.0) 8.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.6sec 23.68% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.6 45.9 9.0sec 3.8sec 82.29% 99.74% 1.9(1.9) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.84%
  • lunar_empowerment_2:31.79%
  • lunar_empowerment_3:14.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.5 64.5sec 33.8sec 47.76% 0.00% 3.5(48.2) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.0 51.1 11.9sec 4.0sec 85.71% 79.44% 0.3(0.3) 0.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.57%
  • solar_empowerment_2:39.69%
  • solar_empowerment_3:17.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.6 20.2sec 5.0sec 97.50% 92.71% 15.5(15.5) 11.5

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.50%
  • starlord_2:22.60%
  • starlord_3:60.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Strife 2.1 52.3 108.8sec 5.4sec 97.75% 0.00% 39.3(39.3) 1.1

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_strife
  • max_stacks:8
  • duration:14.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:50.47

Stack Uptimes

  • strife_1:3.86%
  • strife_2:3.70%
  • strife_3:3.60%
  • strife_4:3.47%
  • strife_5:3.38%
  • strife_6:3.25%
  • strife_7:3.14%
  • strife_8:73.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:304056
  • name:Strife
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc304081=Your spells and abilities have a chance to increase your Versatility by {$s1=0} for {$304056d=8 seconds}, stacking up to {$304056u=5} times. Being the vicitim of a loss of control or movement impairing effect also grants a stack of Strife.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Thorns 5.0 0.0 45.4sec 45.4sec 20.30% 0.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_thorns
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • thorns_1:20.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:305497
  • name:Thorns
  • tooltip:Melee attackers take Nature damage when hit and their movement speed is slowed by {$232559s1=50}% for {$232559d=4 seconds}.
  • description:Sprout thorns for {$d=12 seconds} on the friendly target. When victim to melee attacks, thorns deals {$305496s1=0} Nature damage back to the attacker. Attackers also have their movement speed reduced by {$232559s1=50}% for {$232559d=4 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:45.00
  • default_chance:100.00%
Torrent of Elements 4.3 1.2 61.0sec 45.5sec 23.63% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.63%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:conflict+strife
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
conflict+strife
starsurge Astral Power 60.8 2432.2 40.0 40.0 1502.2
thorns Mana 5.0 18000.0 3600.0 400.0 43.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.49 747.86 (31.23%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.34%) 40.00 0.00 0.00%
sunfire Astral Power 17.76 53.29 (2.23%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.07 176.27 (7.36%) 4.00 0.01 0.00%
moonfire Astral Power 14.05 42.16 (1.76%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.92 (4.26%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.50 918.00 (38.34%) 12.00 0.06 0.01%
natures_balance Astral Power 400.03 200.02 (8.35%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.24 74.91 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 0.00 60.07
Astral Power 7.99 8.12
Combat End Resource Mean Min Max
Mana 2000.00 2000.00 2000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.64 0.00 54.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data conflict+strife Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data conflict+strife Damage Per Second
Count 7592
Mean 38864.45
Minimum 34699.73
Maximum 43055.95
Spread ( max - min ) 8356.22
Range [ ( max - min ) / 2 * 100% ] 10.75%
Standard Deviation 1337.7459
5th Percentile 36751.57
95th Percentile 41086.54
( 95th Percentile - 5th Percentile ) 4334.97
Mean Distribution
Standard Deviation 15.3531
95.00% Confidence Intervall ( 38834.36 - 38894.54 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4552
0.1 Scale Factor Error with Delta=300 15277
0.05 Scale Factor Error with Delta=300 61107
0.01 Scale Factor Error with Delta=300 1527675
Priority Target DPS
Sample Data conflict+strife Priority Target Damage Per Second
Count 7592
Mean 38864.45
Minimum 34699.73
Maximum 43055.95
Spread ( max - min ) 8356.22
Range [ ( max - min ) / 2 * 100% ] 10.75%
Standard Deviation 1337.7459
5th Percentile 36751.57
95th Percentile 41086.54
( 95th Percentile - 5th Percentile ) 4334.97
Mean Distribution
Standard Deviation 15.3531
95.00% Confidence Intervall ( 38834.36 - 38894.54 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4552
0.1 Scale Factor Error with Delta=300 15277
0.05 Scale Factor Error with Delta=300 61107
0.01 Scale Factor Error with Delta=300 1527675
DPS(e)
Sample Data conflict+strife Damage Per Second (Effective)
Count 7592
Mean 38864.45
Minimum 34699.73
Maximum 43055.95
Spread ( max - min ) 8356.22
Range [ ( max - min ) / 2 * 100% ] 10.75%
Damage
Sample Data conflict+strife Damage
Count 7592
Mean 11612398.26
Minimum 9158773.32
Maximum 14430934.53
Spread ( max - min ) 5272161.22
Range [ ( max - min ) / 2 * 100% ] 22.70%
DTPS
Sample Data conflict+strife Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data conflict+strife Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data conflict+strife Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data conflict+strife Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data conflict+strife Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data conflict+strife Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data conflict+strifeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data conflict+strife Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
H 5.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.75 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.81 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.87 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.89 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.65 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.17 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.88 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.75 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.24 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQRKRQKRQKRQNRQORQRKPKRQLQKRQQRRRRKRKRQRQRMKKNQHPQKRQKRQQRRQKNOKQQRPKQRRRRRNRKRKRQKMQQHQKPQNRRRKQQKORQRKQNRRPQRRKKQGQKORQKRQLKRHQRQRPKRKRQQKNORQQKRQRRRKQPKNQORKRQKRQLQHRKQRRIEFKPKRORQKRNRQRQRKRQKRLQKQPQOQRRKRQRKRKNQKQQRKROPQRRRJKGKNQQKRQRKRQRRORPQRRKRKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask conflict+strife 58.0/100: 58% astral_power
Pre precombat 1 food conflict+strife 58.0/100: 58% astral_power
Pre precombat 2 augmentation conflict+strife 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H thorns Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:00.834 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power thorns, lunar_empowerment, battle_potion_of_intellect
0:02.083 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, thorns, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:03.017 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, thorns, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:03.951 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, thorns, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.885 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, thorns, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, strife, battle_potion_of_intellect
0:05.699 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, thorns, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, strife, battle_potion_of_intellect
0:05.699 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, thorns, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, strife, battle_potion_of_intellect
0:05.699 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, thorns, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, strife, battle_potion_of_intellect, ignition_mages_fuse
0:06.454 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), strife, battle_potion_of_intellect, ignition_mages_fuse
0:07.210 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), strife, battle_potion_of_intellect, ignition_mages_fuse
0:08.085 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), strife, battle_potion_of_intellect, ignition_mages_fuse
0:08.839 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), strife, battle_potion_of_intellect, ignition_mages_fuse
0:09.594 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), strife, battle_potion_of_intellect, ignition_mages_fuse
0:10.349 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), strife, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.105 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.859 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, thorns, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.613 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.373 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, strife(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.127 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers, strife(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.881 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, strife(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.637 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.393 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.147 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.901 default O moonfire Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.655 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, strife(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.410 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.208 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.964 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(14), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.720 default P stellar_flare Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(13), conch_of_dark_whispers, strife(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.476 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(12), conch_of_dark_whispers, strife(5), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.230 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(11), conch_of_dark_whispers, strife(5), ignition_mages_fuse(5)
0:23.984 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(11), conch_of_dark_whispers, strife(5), ignition_mages_fuse(5)
0:24.786 default L sunfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), conch_of_dark_whispers, strife(5), ignition_mages_fuse(5)
0:25.540 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), conch_of_dark_whispers, strife(6), ignition_mages_fuse(5)
0:26.468 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8), conch_of_dark_whispers, strife(6)
0:27.351 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), conch_of_dark_whispers, strife(6)
0:28.106 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers, strife(6)
0:29.204 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers, strife(6)
0:30.306 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers, strife(6)
0:31.061 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(3), strife(6)
0:31.817 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(3), strife(6)
0:32.690 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(2), strife(6)
0:33.567 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power, strife(7)
0:34.445 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), strife(7)
0:35.200 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), strife(7)
0:35.967 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), strife(7)
0:36.722 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), strife(8)
0:37.701 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), strife(8)
0:38.469 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), strife(8)
0:39.446 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), strife(8)
0:40.203 default M moonfire Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), strife(8)
0:40.971 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, strife(8)
0:41.932 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, strife(8)
0:43.144 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), strife(8)
0:44.322 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), strife(8)
0:45.823 default H thorns Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8)
0:46.607 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power thorns, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8)
0:47.783 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power thorns, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8)
0:49.283 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8)
0:50.460 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
0:51.432 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
0:52.890 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power thorns, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
0:54.035 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power thorns, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), strife(8)
0:55.009 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power thorns, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
0:56.467 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power thorns, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
0:57.926 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), strife(8)
0:58.899 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), strife(8)
0:59.872 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), strife(8)
1:01.331 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(5), strife(8)
1:02.578 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, strife(8)
1:03.793 default O moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, strife(8)
1:05.006 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, strife(8)
1:06.218 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), strife(8)
1:07.718 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), strife(8)
1:09.217 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), strife(8)
1:10.219 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), strife(8)
1:11.396 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), strife(8)
1:12.575 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
1:14.034 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), strife(8)
1:15.007 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), strife(8)
1:15.980 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), starlord(3), strife(8)
1:17.127 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), starlord(3), strife(8)
1:18.273 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), starlord(3), strife(8)
1:19.417 default N sunfire Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(8), starlord(3), strife(8)
1:20.563 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), starlord(3), strife(8)
1:21.707 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), strife(8)
1:22.955 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, strife(8)
1:23.852 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power celestial_alignment, lunar_empowerment, starlord, strife(8)
1:24.907 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), strife(8)
1:25.777 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), strife(8)
1:27.082 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
1:28.107 default M moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:29.103 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), strife
1:30.563 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), strife
1:32.022 default H thorns Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), strife(2)
1:32.786 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power thorns, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), strife(2)
1:34.246 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power thorns, arcanic_pulsar(2), solar_empowerment, starlord(3), strife(2)
1:35.392 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), strife(3)
1:36.540 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), strife(3)
1:37.999 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power thorns, arcanic_pulsar(3), solar_empowerment(2), starlord(3), strife(4)
1:39.143 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power thorns, arcanic_pulsar(3), solar_empowerment(2), starlord(3), strife(4)
1:40.117 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power thorns, arcanic_pulsar(3), solar_empowerment, starlord(3), strife(4)
1:41.091 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power thorns, arcanic_pulsar(3), starlord(3), strife(4)
1:42.237 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, strife(5)
1:43.486 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, strife(5)
1:45.028 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, strife(5)
1:46.572 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, torrent_of_elements, strife(5)
1:47.784 default O moonfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, strife(5)
1:48.963 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, strife(5)
1:49.964 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, strife(5)
1:51.465 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, strife(5)
1:52.466 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, strife(5)
1:53.644 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, strife(5)
1:55.104 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, strife(5)
1:56.249 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, strife(6)
1:57.220 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, strife(6)
1:58.193 default P stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), strife(6)
1:59.339 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), strife(7)
2:00.798 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(24), strife(7)
2:01.849 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(23), strife(8)
2:02.903 default K starsurge Fluffy_Pillow 97.5/100: 98% astral_power arcanic_pulsar(6), overwhelming_power(22), strife(8)
2:04.057 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), strife(8)
2:05.184 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), strife(8)
2:06.584 default G use_items Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), strife(8)
2:06.584 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), strife(8), ignition_mages_fuse
2:07.936 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(17), strife(8), ignition_mages_fuse
2:08.999 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), strife(8), ignition_mages_fuse
2:09.903 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15), strife(8), ignition_mages_fuse
2:10.675 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), strife(8), ignition_mages_fuse(2)
2:11.790 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(13), strife(8), ignition_mages_fuse(2)
2:12.669 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12), strife(8), ignition_mages_fuse(2)
2:13.423 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), strife(8), ignition_mages_fuse(2)
2:14.550 default L sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(10), strife(8), ignition_mages_fuse(2)
2:15.439 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(9), strife(8), ignition_mages_fuse(3)
2:16.426 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8), strife(8), ignition_mages_fuse(3)
2:17.268 default H thorns Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), strife(8), ignition_mages_fuse(3)
2:18.021 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power thorns, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), strife(8), ignition_mages_fuse(3)
2:19.290 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power thorns, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers, strife(8), ignition_mages_fuse(4)
2:20.112 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power thorns, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers, strife(8), ignition_mages_fuse(4)
2:21.344 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power thorns, arcanic_pulsar(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers, strife(8), ignition_mages_fuse(4)
2:22.169 default P stellar_flare Fluffy_Pillow 64.5/100: 65% astral_power thorns, arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers, strife(8), ignition_mages_fuse(4)
2:23.143 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power thorns, arcanic_pulsar(2), solar_empowerment(2), torrent_of_elements, overwhelming_power, conch_of_dark_whispers, strife(8), ignition_mages_fuse(5)
2:24.171 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, conch_of_dark_whispers, strife(8), ignition_mages_fuse(5)
2:25.021 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power thorns, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, strife(8), ignition_mages_fuse(5)
2:26.021 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8), ignition_mages_fuse(5)
2:26.847 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:28.348 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power thorns, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:29.848 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:31.024 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, strife(8)
2:32.170 default O moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, strife(8)
2:33.317 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, strife(8)
2:34.289 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), strife(8)
2:35.748 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
2:37.208 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), strife(8)
2:38.354 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), strife(8)
2:39.328 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), strife(8)
2:40.788 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), strife(8)
2:41.761 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, strife(8)
2:42.734 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, strife(8)
2:43.880 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), torrent_of_elements, strife(8)
2:45.128 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, strife(8)
2:46.673 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, strife(8)
2:47.888 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, strife(8)
2:49.102 default N sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
2:50.279 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
2:51.778 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
2:52.955 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, strife(8)
2:53.956 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, strife(8)
2:55.134 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
2:55.982 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, strife(8)
2:57.253 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, strife(8)
2:58.250 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
2:59.097 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, strife(8)
3:00.367 default L sunfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, strife(8)
3:01.363 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), strife(8)
3:02.822 default H thorns Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord(3), strife(8)
3:03.588 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power thorns, arcanic_pulsar, solar_empowerment, starlord(3), strife(8)
3:04.562 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power thorns, arcanic_pulsar, strife(8)
3:05.811 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power thorns, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, strife(8)
3:07.356 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power thorns, arcanic_pulsar(2), solar_empowerment, starlord, strife(8)
3:08.386 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power thorns, arcanic_pulsar(2), starlord, strife(8)
3:09.596 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, starlord, strife(8)
3:10.652 default E potion Fluffy_Pillow 88.0/100: 88% astral_power thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, starlord, strife(8)
3:10.652 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, starlord, strife(8), battle_potion_of_intellect
3:10.652 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power berserking, thorns, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, starlord, strife(8), battle_potion_of_intellect
3:11.613 default P stellar_flare Fluffy_Pillow 48.5/100: 49% astral_power berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), strife(8), battle_potion_of_intellect
3:12.545 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power berserking, thorns, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), strife(8), battle_potion_of_intellect
3:13.478 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power berserking, thorns, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), strife(8), battle_potion_of_intellect
3:14.249 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power berserking, thorns, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:15.158 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:15.929 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), strife(8), battle_potion_of_intellect
3:17.084 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), strife(8), battle_potion_of_intellect
3:17.992 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:18.762 default N sunfire Fluffy_Pillow 20.5/100: 21% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), strife(8), battle_potion_of_intellect
3:19.668 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), strife(8), battle_potion_of_intellect
3:20.575 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), strife(8), battle_potion_of_intellect
3:21.730 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), strife(8), battle_potion_of_intellect
3:22.501 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), strife(8), battle_potion_of_intellect
3:23.655 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(25), strife(8), battle_potion_of_intellect
3:24.565 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(24), strife(8), battle_potion_of_intellect
3:25.562 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), strife(8), battle_potion_of_intellect
3:26.386 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(22), strife(8), battle_potion_of_intellect
3:27.626 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(21), strife(8), battle_potion_of_intellect
3:28.602 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), strife(8), battle_potion_of_intellect
3:29.412 default L sunfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(19), strife(8), battle_potion_of_intellect
3:30.369 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment(3), starlord(2), overwhelming_power(18), strife(8), battle_potion_of_intellect
3:31.772 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment(2), starlord(2), overwhelming_power(17), strife(8), battle_potion_of_intellect
3:32.877 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), strife(8), battle_potion_of_intellect
3:34.255 default P stellar_flare Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), strife(8), battle_potion_of_intellect
3:35.343 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), strife(8), battle_potion_of_intellect
3:36.735 default O moonfire Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), strife(8)
3:37.831 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), strife(8)
3:39.231 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), strife(8)
3:40.173 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(8), strife(8)
3:41.286 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(7), strife(8)
3:42.402 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), strife(8)
3:43.231 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), strife(8)
3:44.475 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(4), strife(8)
3:45.457 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power celestial_alignment, torrent_of_elements, overwhelming_power(3), strife(8)
3:46.531 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(2), strife(8)
3:47.421 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power, strife(8)
3:48.470 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, strife(8)
3:49.649 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, strife(8)
3:51.150 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, strife(8)
3:52.327 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, strife(8)
3:53.787 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
3:55.247 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, strife(8)
3:56.221 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
3:57.367 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers, strife(8)
3:58.341 default O moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
3:59.487 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
4:00.632 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
4:02.093 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), conch_of_dark_whispers, strife(8)
4:03.066 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), conch_of_dark_whispers, strife(8)
4:04.040 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(4), starlord(3), conch_of_dark_whispers, strife(8)
4:05.187 default J cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(4), starlord(3), conch_of_dark_whispers, strife(8)
4:05.187 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(4), conch_of_dark_whispers, strife(8)
4:06.435 default G use_items Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(8)
4:06.435 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, strife(8), ignition_mages_fuse
4:07.599 default N sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(8), ignition_mages_fuse
4:08.727 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, strife(8), ignition_mages_fuse
4:10.168 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), strife(8), ignition_mages_fuse
4:11.488 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(24), strife(8), ignition_mages_fuse(2)
4:12.491 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), strife(8), ignition_mages_fuse(2)
4:13.323 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), strife(8), ignition_mages_fuse(2)
4:14.573 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(21), strife(8), ignition_mages_fuse(3)
4:15.382 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(20), strife(8), ignition_mages_fuse(3)
4:16.337 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19), strife(8), ignition_mages_fuse(3)
4:17.150 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), strife(8), ignition_mages_fuse(3)
4:18.372 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(17), strife(8), ignition_mages_fuse(3)
4:19.190 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(16), strife(8), ignition_mages_fuse(4)
4:19.983 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), strife(8), ignition_mages_fuse(4)
4:20.915 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(15), strife(8), ignition_mages_fuse(4)
4:21.849 default P stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), strife(8), ignition_mages_fuse(4)
4:22.787 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), strife(8), ignition_mages_fuse(5)
4:23.943 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(12), strife(8), ignition_mages_fuse(5)
4:24.854 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(11), strife(8), ignition_mages_fuse(5)
4:25.769 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(10), strife(8), ignition_mages_fuse(5)
4:26.767 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(9), strife(8)
4:27.635 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(8), strife(8)
4:28.660 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(7), strife(8)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="conflict+strife"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

crucible of flame : 37153 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
37153.4 37153.4 26.3 / 0.071% 4551.1 / 12.2% 4690.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 7.8 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
crucible of flame 37153
Ancient Flame 1254 3.4% 24.9 11.81sec 15074 0 Periodic 89.8 3544 7085 4181 18.0% 57.9%

Stats details: ancient_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.90 0.00 89.77 89.77 0.0000 1.9314 375305.55 375305.55 0.00 2164.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.6 82.01% 3543.72 2 6423 3523.61 2013 5144 260894 260894 0.00
crit 16.1 17.99% 7085.42 4 12846 7043.11 3628 11133 114412 114412 0.00
 
 

Action details: ancient_flame

Static Values
  • id:295367
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295367
  • name:Ancient Flame
  • school:fire
  • tooltip:Suffering $w1 fire damage every $t1 sec.
  • description:{$@spelldesc295365=Your spells and abilities have a chance to cauterize your target for ${$m3*5} Fire damage over {$295367d=10 seconds} or healing an ally for ${$m3*5} over {$295367d=10 seconds}$?a295369[, stacking up to {$295367u=1} times][].}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1313.31
  • base_td_mult:1.35
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Concentrated Flame 0 (1879) 0.0% (5.1%) 11.5 29.91sec 49027 45336

Stats details: concentrated_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.47 0.00 0.00 0.00 1.0815 0.0000 0.00 0.00 0.00 45335.96 45335.96
 
 

Action details: concentrated_flame

Static Values
  • id:295373
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295373
  • name:Concentrated Flame
  • school:fire
  • tooltip:
  • description:Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.
 
    Concentrated Flame (_missile) 1138 3.1% 11.5 29.91sec 29688 0 Direct 11.5 25144 50766 29686 17.7%  

Stats details: concentrated_flame_missile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.47 11.47 0.00 0.00 0.0000 0.0000 340605.40 340605.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.44 82.27% 25144.29 12753 42084 25116.63 17004 35283 237335 237335 0.00
crit 2.03 17.73% 50766.33 25506 84168 45412.69 0 84168 103270 103270 0.00
 
 

Action details: concentrated_flame_missile

Static Values
  • id:295374
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295374
  • name:Concentrated Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc295373=Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11614.19
  • base_dd_max:11614.19
  • base_dd_mult:1.00
 
    Concentrated Flame (_burn) 741 2.0% 11.5 29.91sec 19339 0 Periodic 32.0 6929 0 6929 0.0% 21.4%

Stats details: concentrated_flame_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.47 0.00 32.02 32.02 0.0000 2.0000 221877.88 221877.88 0.00 3464.41 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.0 100.00% 6928.71 3347 11047 6926.87 6695 7539 221878 221878 0.00
 
 

Action details: concentrated_flame_burn

Static Values
  • id:295368
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295368
  • name:Concentrated Flame
  • school:fire
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:{$@spelldesc295373=Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3188.20
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Heed My Call 292 (417) 0.8% (1.1%) 8.1 33.55sec 15389 0 Direct 8.1 9106 18228 10780 18.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.11 8.11 0.00 0.00 0.0000 0.0000 87440.21 87440.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.62 81.64% 9105.64 8901 9791 9105.33 0 9791 60300 60300 0.00
crit 1.49 18.36% 18228.11 17802 19582 14233.10 0 19582 27140 27140 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.3% 8.1 33.55sec 4609 0 Direct 8.1 3903 7808 4609 18.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.11 8.11 0.00 0.00 0.0000 0.0000 37383.78 37383.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.64 81.92% 3902.88 3815 4196 3903.25 3815 4196 25933 25933 0.00
crit 1.47 18.08% 7807.97 7629 8392 6037.88 0 8392 11450 11450 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 4841 13.0% 74.0 3.93sec 19581 14976 Direct 74.0 16597 33183 19581 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.01 74.01 0.00 0.00 1.3075 0.0000 1449127.24 1449127.24 0.00 14975.74 14975.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.69 82.01% 16597.19 8882 21253 16604.54 15997 17610 1007355 1007355 0.00
crit 13.31 17.99% 33183.46 17765 42507 33205.28 28416 38633 441773 441773 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2431 6.5% 14.1 21.27sec 51738 50154 Direct 14.1 2848 5702 3357 17.8%  
Periodic 219.6 2626 5248 3097 18.0% 98.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 219.63 219.63 1.0316 1.3450 727383.44 727383.44 0.00 2347.19 50154.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 82.18% 2848.27 2589 3565 2849.61 2632 3127 32909 32909 0.00
crit 2.50 17.82% 5701.62 5177 7129 5313.53 0 7129 14281 14281 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.2 82.03% 2625.72 1 3319 2627.01 2536 2742 473042 473042 0.00
crit 39.5 17.97% 5248.02 24 6638 5250.61 4883 5770 207152 207152 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 787 2.1% 43.8 6.64sec 5380 0 Direct 43.8 4557 9110 5380 18.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.78 43.78 0.00 0.00 0.0000 0.0000 235503.68 235503.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.87 81.94% 4557.27 4180 5756 4559.68 4308 4978 163461 163461 0.00
crit 7.91 18.06% 9109.85 8360 11513 9114.82 0 11513 72043 72043 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2689 (4268) 7.2% (11.5%) 88.7 3.30sec 14394 15953 Direct 89.3 7646 15276 9016 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.75 89.28 0.00 0.00 0.9023 0.0000 804934.11 804934.11 0.00 15952.50 15952.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.26 82.05% 7645.93 6967 9594 7651.18 7401 8044 560114 560114 0.00
crit 16.03 17.95% 15276.13 13933 19188 15284.69 13933 17549 244820 244820 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1579 4.3% 71.6 4.07sec 6601 0 Direct 71.6 6602 0 6602 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.57 71.57 0.00 0.00 0.0000 0.0000 472462.53 472462.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.57 100.00% 6601.51 5086 14007 6605.35 5672 7744 472463 472463 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 11443 30.8% 59.2 5.08sec 57828 54944 Direct 59.0 49253 98440 58012 17.8%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.20 59.01 0.00 0.00 1.0525 0.0000 3423461.90 3423461.90 0.00 54944.18 54944.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.50 82.19% 49252.64 45067 61614 49277.91 47495 51734 2388984 2388984 0.00
crit 10.51 17.81% 98439.83 90135 123227 98488.30 90135 114906 1034478 1034478 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1575 4.2% 12.7 23.58sec 37140 35546 Direct 12.7 2368 4738 2789 17.8%  
Periodic 217.3 1702 3403 2007 17.9% 97.8%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.69 12.69 217.26 217.26 1.0449 1.3483 471408.05 471408.05 0.00 1539.57 35545.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 82.22% 2367.66 2231 3073 2368.68 2231 2535 24709 24709 0.00
crit 2.26 17.78% 4737.89 4463 6146 4334.39 0 6146 10693 10693 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.3 82.08% 1702.07 6 2151 1702.94 1656 1777 303534 303534 0.00
crit 38.9 17.92% 3402.74 40 4302 3404.22 3211 3754 132472 132472 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5555 14.9% 85.7 3.24sec 19268 0 Direct 85.7 16357 32722 19268 17.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.74 85.74 0.00 0.00 0.0000 0.0000 1652094.93 1652094.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.49 82.21% 16356.84 15985 17583 16357.03 15985 17172 1152944 1152944 0.00
crit 15.25 17.79% 32721.95 31970 35167 32722.56 31970 35167 499151 499151 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2703 7.3% 17.7 16.80sec 45746 44564 Direct 17.7 3905 7807 4604 17.9%  
Periodic 218.8 2821 5638 3325 17.9% 98.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.68 17.68 218.77 218.77 1.0266 1.3465 808885.12 808885.12 0.00 2586.53 44564.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.52 82.09% 3905.16 3570 4917 3906.52 3627 4333 56683 56683 0.00
crit 3.17 17.91% 7807.31 7141 9834 7577.23 0 9834 24726 24726 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.6 82.09% 2820.81 7 3565 2822.22 2747 2944 506605 506605 0.00
crit 39.2 17.91% 5637.89 23 7129 5640.40 5292 6116 220870 220870 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
crucible of flame
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Berserking 2.0 181.45sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 185.50sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8742 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.0 52.0 45.4sec 5.1sec 92.70% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.75%
  • arcanic_pulsar_2:10.62%
  • arcanic_pulsar_3:11.56%
  • arcanic_pulsar_4:10.62%
  • arcanic_pulsar_5:13.42%
  • arcanic_pulsar_6:9.77%
  • arcanic_pulsar_7:11.00%
  • arcanic_pulsar_8:14.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.4sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.4sec 181.4sec 8.12% 8.20% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.1 0.0 38.2sec 38.2sec 25.56% 32.31% 0.0(0.0) 7.9

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.5sec 23.55% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.15% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 32.0 45.1 9.4sec 3.9sec 82.25% 99.73% 2.0(2.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.40%
  • lunar_empowerment_2:31.72%
  • lunar_empowerment_3:15.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.6sec 34.1sec 47.52% 0.00% 3.4(47.5) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 23.7 50.3 12.4sec 4.1sec 85.88% 80.30% 0.3(0.3) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.97%
  • solar_empowerment_2:39.92%
  • solar_empowerment_3:18.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.1 44.1 20.3sec 5.1sec 96.82% 92.14% 14.3(14.3) 11.4

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.80%
  • starlord_2:23.09%
  • starlord_3:58.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.0sec 45.7sec 23.69% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.69%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
crucible of flame
starsurge Astral Power 59.2 2368.0 40.0 40.0 1445.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 89.74 717.90 (30.80%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.43%) 40.00 0.00 0.00%
sunfire Astral Power 17.68 53.05 (2.28%) 3.00 0.00 0.00%
shooting_stars Astral Power 43.78 175.09 (7.51%) 4.00 0.01 0.01%
moonfire Astral Power 14.06 42.18 (1.81%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.69 101.54 (4.36%) 8.00 0.00 0.00%
lunar_strike Astral Power 74.01 888.05 (38.10%) 12.00 0.06 0.01%
natures_balance Astral Power 400.03 200.01 (8.58%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.09 73.05 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.78 7.90
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.37 0.00 79.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data crucible of flame Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data crucible of flame Damage Per Second
Count 7592
Mean 37153.41
Minimum 33694.85
Maximum 42189.36
Spread ( max - min ) 8494.51
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 1167.7236
5th Percentile 35310.43
95th Percentile 39134.25
( 95th Percentile - 5th Percentile ) 3823.82
Mean Distribution
Standard Deviation 13.4018
95.00% Confidence Intervall ( 37127.15 - 37179.68 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3795
0.1 Scale Factor Error with Delta=300 11641
0.05 Scale Factor Error with Delta=300 46562
0.01 Scale Factor Error with Delta=300 1164029
Priority Target DPS
Sample Data crucible of flame Priority Target Damage Per Second
Count 7592
Mean 37153.41
Minimum 33694.85
Maximum 42189.36
Spread ( max - min ) 8494.51
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 1167.7236
5th Percentile 35310.43
95th Percentile 39134.25
( 95th Percentile - 5th Percentile ) 3823.82
Mean Distribution
Standard Deviation 13.4018
95.00% Confidence Intervall ( 37127.15 - 37179.68 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3795
0.1 Scale Factor Error with Delta=300 11641
0.05 Scale Factor Error with Delta=300 46562
0.01 Scale Factor Error with Delta=300 1164029
DPS(e)
Sample Data crucible of flame Damage Per Second (Effective)
Count 7592
Mean 37153.41
Minimum 33694.85
Maximum 42189.36
Spread ( max - min ) 8494.51
Range [ ( max - min ) / 2 * 100% ] 11.43%
Damage
Sample Data crucible of flame Damage
Count 7592
Mean 11107873.83
Minimum 8682580.02
Maximum 13619623.13
Spread ( max - min ) 4937043.11
Range [ ( max - min ) / 2 * 100% ] 22.22%
DTPS
Sample Data crucible of flame Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data crucible of flame Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data crucible of flame Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data crucible of flame Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data crucible of flame Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data crucible of flame Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data crucible of flameTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data crucible of flame Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
H 11.47 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.72 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.20 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.93 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.61 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.46 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.44 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.69 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 74.35 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 89.00 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.29 sunfire

Sample Sequence

0123456789ACDHHKONPIFGKRKRQRQKRQKRQNRQORQRKPKRLQKQRQHQQRKRKRQRQRJKKONQQKPRQQKRQQRQHKNORQKRQKPRQRQRJKNRQKRMQRKHRQRKPQNRKRQQRKORQRKRQNRJKPHQKRQGKRQKRQKNORQQKRQRKPQRRKQHNOQRRRRKKQQRKPQNQRORRQJKRKHRKRLQIEFKRQKRPRQRORSKRQKRQKRLQKQHQRQPOKRKRQKLRQQKRQRRRRRKOHKNPQGQRKRQRQRQJKRKNORQRQKRQK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask crucible of flame 58.0/100: 58% astral_power
Pre precombat 1 food crucible of flame 58.0/100: 58% astral_power
Pre precombat 2 augmentation crucible of flame 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H concentrated_flame Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.247 default H concentrated_flame Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.207 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:03.168 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.102 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.035 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.969 default I celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:06.781 default F berserking Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:06.781 default G use_items Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:06.781 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:07.536 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.291 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.044 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.800 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:10.652 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:11.404 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.224 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.977 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.731 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.551 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.306 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.059 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.847 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.603 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.358 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.146 default O moonfire Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.901 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.657 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.493 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.247 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.001 default P stellar_flare Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, ignition_mages_fuse(5)
0:23.756 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, ignition_mages_fuse(5)
0:24.509 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
0:25.265 default L sunfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:26.020 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(24), ignition_mages_fuse(5)
0:26.907 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24)
0:27.739 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:28.773 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22)
0:29.526 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21)
0:30.567 default H concentrated_flame Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
0:31.387 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
0:32.435 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
0:33.487 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:34.241 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:35.074 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:35.829 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:36.583 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:37.338 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:38.271 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:39.026 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:39.964 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:40.720 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:40.720 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, overwhelming_power(10), conch_of_dark_whispers
0:41.527 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(9), conch_of_dark_whispers
0:42.700 default O moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers
0:43.777 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
0:44.858 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(23), conch_of_dark_whispers
0:46.238 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), conch_of_dark_whispers
0:47.630 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers
0:48.726 default P stellar_flare Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), conch_of_dark_whispers
0:49.795 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), conch_of_dark_whispers
0:50.706 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:52.076 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:53.459 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
0:54.549 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
0:55.478 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
0:56.875 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
0:58.278 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
0:59.221 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
1:00.639 default H concentrated_flame Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
1:01.754 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(5), solar_empowerment(2), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
1:02.974 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
1:04.164 default O moonfire Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
1:05.362 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers
1:06.386 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power
1:07.924 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
1:09.137 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:10.139 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:11.638 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:12.815 default P stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:13.959 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:14.932 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:16.391 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:17.365 default Q lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
1:18.703 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(23)
1:19.601 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
1:19.601 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), overwhelming_power(22)
1:20.752 default N sunfire Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(21)
1:21.728 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(20)
1:22.560 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(19)
1:23.814 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18)
1:24.802 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(17)
1:25.620 default M moonfire Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24)
1:26.560 default Q lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
1:27.940 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(22)
1:28.865 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21)
1:29.957 default H concentrated_flame Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(20)
1:31.072 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(18)
1:31.984 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18)
1:33.349 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
1:34.267 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
1:35.351 default P stellar_flare Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers
1:36.440 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
1:37.829 default N sunfire Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), conch_of_dark_whispers
1:38.926 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), conch_of_dark_whispers
1:39.861 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), overwhelming_power(10), conch_of_dark_whispers
1:41.066 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
1:42.066 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
1:43.570 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
1:45.081 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
1:46.096 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
1:47.295 default O moonfire Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers
1:48.466 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power, conch_of_dark_whispers
1:49.462 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:50.964 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:51.965 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:53.143 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:54.116 default Q lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:55.574 default N sunfire Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:56.720 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:57.694 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3)
1:57.694 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment
1:58.942 default P stellar_flare Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord
2:00.153 default H concentrated_flame Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord
2:01.365 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord
2:02.910 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
2:04.122 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
2:05.123 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
2:06.623 default G use_items Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:06.623 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse
2:07.753 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
2:08.565 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:09.783 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:10.739 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:11.520 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:12.689 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:13.609 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:14.667 default O moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:15.683 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:16.550 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:17.845 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), torrent_of_elements, ignition_mages_fuse(3)
2:19.256 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), solar_empowerment(2), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.324 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.206 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.528 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse(4)
2:23.409 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.408 default P stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.380 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.618 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
2:27.443 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), conch_of_dark_whispers
2:28.445 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
2:29.622 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
2:31.082 default H concentrated_flame Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
2:32.228 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
2:33.372 default O moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
2:34.518 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
2:35.979 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
2:36.953 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
2:38.100 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
2:39.244 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(25)
2:40.292 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(5), torrent_of_elements, overwhelming_power(24)
2:41.435 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23)
2:42.550 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22)
2:43.936 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21)
2:45.325 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19)
2:46.260 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(18)
2:47.364 default P stellar_flare Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
2:48.440 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
2:49.816 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15)
2:50.900 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
2:52.286 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
2:53.176 default O moonfire Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
2:54.227 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
2:55.122 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(22)
2:56.179 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
2:57.533 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(25)
2:57.533 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(25)
2:58.673 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24)
2:59.496 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(23)
3:00.467 default H concentrated_flame Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22)
3:01.414 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24)
3:02.213 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(23)
3:03.158 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22)
3:03.940 default L sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22)
3:04.860 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(21)
3:06.213 default I celestial_alignment Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19)
3:07.142 default E potion Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18)
3:07.142 default F berserking Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:07.142 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:07.991 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect
3:08.745 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), battle_potion_of_intellect
3:09.829 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:10.683 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:11.439 default P stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:12.300 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:13.164 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:14.268 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:15.138 default O moonfire Fluffy_Pillow 74.5/100: 75% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:16.010 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:16.885 default S sunfire Fluffy_Pillow 86.5/100: 87% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:17.761 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), overwhelming_power(8), battle_potion_of_intellect
3:18.721 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(7), battle_potion_of_intellect
3:19.515 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(6), battle_potion_of_intellect
3:20.828 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(5), battle_potion_of_intellect
3:21.862 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(4), battle_potion_of_intellect
3:22.720 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(3), battle_potion_of_intellect
3:24.010 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power, battle_potion_of_intellect
3:25.030 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:25.878 default L sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:26.875 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:28.334 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:29.479 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:30.939 default H concentrated_flame Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:32.084 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:33.542 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:34.515 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:35.975 default P stellar_flare Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
3:37.120 default O moonfire Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
3:38.266 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(8), solar_empowerment(2)
3:39.515 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord
3:40.412 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord
3:41.466 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:42.337 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:43.642 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
3:44.667 default L sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:45.664 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:46.637 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:48.098 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
3:49.558 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
3:50.704 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3)
3:51.676 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
3:53.135 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3)
3:54.109 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
3:55.082 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
3:56.054 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), starlord(3)
3:57.199 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(3), starlord(3)
3:58.344 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(3)
3:59.594 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
4:00.807 default H concentrated_flame Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
4:02.020 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
4:03.233 default N sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:04.412 default P stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:05.589 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:07.090 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
4:07.090 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
4:08.528 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), ignition_mages_fuse
4:09.490 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
4:10.621 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse
4:11.556 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:12.902 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
4:13.801 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:15.145 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:16.012 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:17.308 default J cancel_buff Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:17.308 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(6), solar_empowerment(2), ignition_mages_fuse(3)
4:18.415 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, ignition_mages_fuse(3)
4:19.330 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(4)
4:20.367 default N sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(4)
4:21.299 default O moonfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(4)
4:22.235 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(4)
4:23.032 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(4)
4:24.232 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(5)
4:25.007 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.172 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.089 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.844 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
4:29.031 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="crucible of flame"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

focusing iris : 36706 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36705.6 36705.6 25.7 / 0.070% 4369.7 / 11.9% 4303.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.4 Astral Power 0.00% 60.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 36706
Heed My Call 306 (437) 0.8% (1.2%) 8.5 32.28sec 15362 0 Direct 8.5 9107 18217 10753 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.52 8.52 0.00 0.00 0.0000 0.0000 91605.73 91605.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.98 81.93% 9107.10 8901 9791 9106.83 8901 9791 63566 63566 0.00
crit 1.54 18.07% 18216.68 17802 19582 14471.79 0 19582 28040 28040 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 131 0.4% 8.5 32.28sec 4609 0 Direct 8.5 3903 7805 4608 18.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.52 8.52 0.00 0.00 0.0000 0.0000 39261.16 39261.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.98 81.92% 3903.33 3815 4196 3903.73 3815 4196 27241 27241 0.00
crit 1.54 18.08% 7804.55 7629 8392 6198.77 0 8392 12020 12020 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5274 14.4% 80.7 3.63sec 19569 15556 Direct 80.7 16589 33167 19569 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.67 80.67 0.00 0.00 1.2580 0.0000 1578542.45 1578542.45 0.00 15555.67 15555.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.17 82.03% 16588.88 8882 21253 16595.10 16020 17366 1097655 1097655 0.00
crit 14.50 17.97% 33166.93 17765 42507 33178.29 29788 37575 480888 480888 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2552 7.0% 14.1 21.35sec 53964 55093 Direct 14.1 2855 5715 3366 17.9%  
Periodic 230.6 2633 5261 3104 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.15 14.15 230.64 230.64 0.9795 1.2903 763530.61 763530.61 0.00 2451.63 55092.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.62 82.10% 2854.55 2589 3565 2855.69 2646 3145 33161 33161 0.00
crit 2.53 17.90% 5714.97 5177 7129 5367.16 0 7129 14471 14471 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.3 82.07% 2632.73 4 3319 2633.93 2564 2768 498316 498316 0.00
crit 41.4 17.93% 5260.94 15 6638 5263.38 4904 5695 217583 217583 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 830 2.3% 46.1 6.34sec 5387 0 Direct 46.1 4568 9125 5387 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.10 46.10 0.00 0.00 0.0000 0.0000 248357.12 248357.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.81 82.02% 4568.04 4180 5756 4569.86 4277 4900 172716 172716 0.00
crit 8.29 17.98% 9124.80 8360 11513 9130.19 0 11513 75641 75641 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3010 (4722) 8.2% (12.9%) 99.5 2.96sec 14210 16142 Direct 100.0 7643 15275 9013 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.48 99.98 0.00 0.00 0.8804 0.0000 901074.79 901074.79 0.00 16141.58 16141.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.03 82.05% 7642.90 6967 9594 7647.56 7403 8092 626972 626972 0.00
crit 17.95 17.95% 15274.64 13933 19188 15283.80 13933 17333 274103 274103 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1712 4.7% 77.6 3.77sec 6605 0 Direct 77.6 6605 0 6605 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.60 77.60 0.00 0.00 0.0000 0.0000 512508.17 512508.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.60 100.00% 6604.58 5086 14007 6607.73 5698 7855 512508 512508 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5848.45
  • base_dd_max:5848.45
  • base_dd_mult:1.00
 
Starsurge 12344 33.6% 63.8 4.74sec 57917 57029 Direct 63.5 49286 98493 58109 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.76 63.55 0.00 0.00 1.0156 0.0000 3692614.54 3692614.54 0.00 57028.80 57028.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.15 82.07% 49285.95 45067 61614 49308.92 47445 51922 2570300 2570300 0.00
crit 11.40 17.93% 98492.70 90135 123227 98534.91 90135 113978 1122314 1122314 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1658 4.5% 12.8 23.56sec 38798 39169 Direct 12.8 2428 4861 2862 17.8%  
Periodic 228.3 1706 3410 2013 18.0% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 228.29 228.29 0.9906 1.2921 496069.63 496069.63 0.00 1612.51 39168.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.51 82.17% 2428.06 2231 3073 2429.91 2231 2660 25508 25508 0.00
crit 2.28 17.83% 4861.13 4463 6146 4476.92 0 6146 11085 11085 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 187.2 82.02% 1706.34 1 2151 1707.15 1661 1789 319498 319498 0.00
crit 41.0 17.98% 3410.33 18 4302 3411.88 3235 3685 139978 139978 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6057 16.4% 93.6 3.01sec 19267 0 Direct 93.6 16351 32707 19267 17.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.58 93.58 0.00 0.00 0.0000 0.0000 1802899.09 1802899.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.90 82.17% 16351.26 15985 17583 16351.16 15985 17259 1257333 1257333 0.00
crit 16.68 17.83% 32706.80 31970 35167 32707.14 31970 34634 545566 545566 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2832 7.7% 17.5 17.08sec 48306 48714 Direct 17.5 3913 7828 4616 18.0%  
Periodic 229.9 2828 5653 3335 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.54 17.54 229.86 229.86 0.9917 1.2904 847472.40 847472.40 0.00 2698.87 48713.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.39 82.03% 3912.90 3570 4917 3914.36 3648 4352 56314 56314 0.00
crit 3.15 17.97% 7828.13 7141 9834 7569.43 0 9834 24674 24674 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 188.6 82.06% 2827.71 8 3565 2829.04 2756 2960 533375 533375 0.00
crit 41.2 17.94% 5652.70 21 7129 5655.12 5334 6137 233109 233109 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.62sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.43sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8797 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.5 56.0 42.5sec 4.7sec 93.27% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.54%
  • arcanic_pulsar_2:11.26%
  • arcanic_pulsar_3:11.28%
  • arcanic_pulsar_4:10.82%
  • arcanic_pulsar_5:12.77%
  • arcanic_pulsar_6:11.20%
  • arcanic_pulsar_7:11.39%
  • arcanic_pulsar_8:13.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.4sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.12% 8.40% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.0 0.0 39.4sec 39.4sec 26.53% 32.96% 0.0(0.0) 7.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.6sec 23.69% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Energy 1.0 382.4 0.0sec 0.8sec 100.00% 99.73% 375.4(375.4) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:33.31

Stack Uptimes

  • focused_energy_3:0.42%
  • focused_energy_4:0.31%
  • focused_energy_5:0.41%
  • focused_energy_6:0.21%
  • focused_energy_7:0.20%
  • focused_energy_8:0.20%
  • focused_energy_9:0.20%
  • focused_energy_10:98.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.29% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.91%
  • ignition_mages_fuse_3:3.86%
  • ignition_mages_fuse_4:3.81%
  • ignition_mages_fuse_5:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 36.3 47.5 8.4sec 3.6sec 81.80% 99.77% 2.0(2.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.91%
  • lunar_empowerment_2:31.17%
  • lunar_empowerment_3:14.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.6 63.8sec 33.1sec 48.96% 0.00% 3.6(50.7) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.44%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.52%
  • overwhelming_power_5:1.56%
  • overwhelming_power_6:1.60%
  • overwhelming_power_7:1.65%
  • overwhelming_power_8:1.70%
  • overwhelming_power_9:1.75%
  • overwhelming_power_10:1.80%
  • overwhelming_power_11:1.85%
  • overwhelming_power_12:1.91%
  • overwhelming_power_13:1.96%
  • overwhelming_power_14:2.02%
  • overwhelming_power_15:2.08%
  • overwhelming_power_16:2.14%
  • overwhelming_power_17:2.21%
  • overwhelming_power_18:2.28%
  • overwhelming_power_19:2.35%
  • overwhelming_power_20:2.42%
  • overwhelming_power_21:2.50%
  • overwhelming_power_22:2.58%
  • overwhelming_power_23:2.66%
  • overwhelming_power_24:2.73%
  • overwhelming_power_25:1.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 26.8 53.1 11.2sec 3.8sec 84.73% 77.76% 0.2(0.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.14%
  • solar_empowerment_2:39.16%
  • solar_empowerment_3:16.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 48.4 20.2sec 4.7sec 97.94% 93.15% 18.2(18.2) 11.4

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.44%
  • starlord_2:21.94%
  • starlord_3:62.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.5sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.65%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 63.8 2550.3 40.0 40.0 1447.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 100.48 803.75 (31.99%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.18%) 40.00 0.00 0.00%
sunfire Astral Power 17.54 52.63 (2.09%) 3.00 0.00 0.00%
shooting_stars Astral Power 46.10 184.40 (7.34%) 4.00 0.00 0.00%
moonfire Astral Power 14.15 42.45 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.79 102.29 (4.07%) 8.00 0.00 0.00%
lunar_strike Astral Power 80.67 967.94 (38.52%) 12.00 0.07 0.01%
natures_balance Astral Power 400.03 200.02 (7.96%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.61 79.28 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.39 8.51
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.95 0.00 61.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data focusing iris Damage Per Second
Count 7592
Mean 36705.56
Minimum 32927.59
Maximum 41806.22
Spread ( max - min ) 8878.63
Range [ ( max - min ) / 2 * 100% ] 12.09%
Standard Deviation 1141.8453
5th Percentile 34922.72
95th Percentile 38648.80
( 95th Percentile - 5th Percentile ) 3726.08
Mean Distribution
Standard Deviation 13.1048
95.00% Confidence Intervall ( 36679.88 - 36731.25 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3718
0.1 Scale Factor Error with Delta=300 11131
0.05 Scale Factor Error with Delta=300 44521
0.01 Scale Factor Error with Delta=300 1113008
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 7592
Mean 36705.56
Minimum 32927.59
Maximum 41806.22
Spread ( max - min ) 8878.63
Range [ ( max - min ) / 2 * 100% ] 12.09%
Standard Deviation 1141.8453
5th Percentile 34922.72
95th Percentile 38648.80
( 95th Percentile - 5th Percentile ) 3726.08
Mean Distribution
Standard Deviation 13.1048
95.00% Confidence Intervall ( 36679.88 - 36731.25 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3718
0.1 Scale Factor Error with Delta=300 11131
0.05 Scale Factor Error with Delta=300 44521
0.01 Scale Factor Error with Delta=300 1113008
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 7592
Mean 36705.56
Minimum 32927.59
Maximum 41806.22
Spread ( max - min ) 8878.63
Range [ ( max - min ) / 2 * 100% ] 12.09%
Damage
Sample Data focusing iris Damage
Count 7592
Mean 10973935.68
Minimum 8531955.39
Maximum 13665497.88
Spread ( max - min ) 5133542.49
Range [ ( max - min ) / 2 * 100% ] 23.39%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.97 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 63.76 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.56 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.01 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.74 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.14 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 81.03 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 99.73 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.25 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPJQPQPJQPQMQNQPQJOQPJKPJPPPQQQJQJQPQPQLIJJPMPJOQPQJQPQPQQQJMJNPPQJOPQQPQQPIJMJQPJLPPJQPQOQQQMPJJPPJNQPQJPQQPMQQOPJJQJQGQPQJNPPMPJPQQPQJOPJPQQQJMNPQPQQPQIJJPPJOQPJQPMNQJPPQQJPQHEFJMJQOQPQJNQPJQPQPQJQPKPJQPJQPLJOPPQQPJMPJPQPJPQQJNPOQQMPJPGJPQQPJQPJQPQKNQPOQJJPPJQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power focused_energy(3), battle_potion_of_intellect
0:01.235 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.157 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.077 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:03.992 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:04.782 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.782 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.782 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect, ignition_mages_fuse
0:05.538 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:06.292 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.049 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.804 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.624 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.379 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.133 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.924 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.679 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.469 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.224 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.977 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.740 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.494 default M sunfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.247 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.002 default N moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.758 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.514 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.323 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.078 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.832 default O stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.585 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.340 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.164 default J starsurge Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, focused_energy(10), ignition_mages_fuse(5)
0:23.919 default K sunfire Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10), ignition_mages_fuse(5)
0:24.674 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10), ignition_mages_fuse(5)
0:25.596 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10)
0:26.468 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
0:27.546 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
0:28.625 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
0:29.703 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
0:30.458 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
0:31.212 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(8), starlord(3), focused_energy(10)
0:32.060 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(8), starlord(3), focused_energy(10)
0:32.908 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
0:33.663 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10)
0:34.419 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
0:35.172 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), focused_energy(10)
0:36.111 default Q solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10)
0:36.864 default P lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10)
0:37.803 default Q solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
0:38.558 default L moonfire Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10)
0:39.315 default I cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), focused_energy(10)
0:39.315 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, focused_energy(10)
0:40.240 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, focused_energy(10)
0:41.137 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), focused_energy(10)
0:42.580 default M sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
0:43.715 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
0:45.159 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
0:46.292 default O stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
0:47.391 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
0:48.328 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
0:49.729 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
0:50.665 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
0:51.766 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
0:52.703 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
0:54.106 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
0:55.043 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
0:56.444 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10)
0:57.379 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), focused_energy(10)
0:58.317 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(5), starlord(3), focused_energy(10)
0:59.419 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(5), focused_energy(10)
1:00.619 default M sunfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:01.782 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:02.948 default N moonfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:04.080 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:05.523 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:06.965 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), focused_energy(10)
1:07.928 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), focused_energy(10)
1:09.061 default O stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:10.164 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:11.567 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), focused_energy(10)
1:12.504 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), focused_energy(10)
1:13.440 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), focused_energy(10)
1:14.844 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:15.946 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:17.048 default P lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), focused_energy(10)
1:18.451 default I cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:18.451 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), focused_energy(10)
1:19.652 default M sunfire Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:20.664 default J starsurge Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:21.676 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:22.514 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10)
1:23.769 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10)
1:24.756 default L moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:25.716 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:27.120 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:28.522 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:29.625 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:30.560 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:31.963 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), focused_energy(10)
1:32.899 default O stellar_flare Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10)
1:34.001 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10)
1:34.937 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10)
1:35.873 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), starlord(3), focused_energy(10)
1:36.972 default M sunfire Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(25), focused_energy(10)
1:37.982 default P lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10)
1:39.272 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(3), overwhelming_power(22), focused_energy(10)
1:40.385 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), focused_energy(10)
1:41.466 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), focused_energy(10)
1:42.810 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), focused_energy(10)
1:44.158 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(25), focused_energy(10)
1:45.196 default N moonfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), focused_energy(10)
1:46.209 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), focused_energy(10)
1:47.072 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10)
1:48.370 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10)
1:49.239 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(20), focused_energy(10)
1:50.264 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10)
1:51.578 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10)
1:52.457 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10)
1:53.340 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10)
1:54.665 default M sunfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(15), focused_energy(10)
1:55.712 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(14), focused_energy(10)
1:56.760 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(13), focused_energy(10)
1:57.812 default O stellar_flare Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
1:58.867 default P lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10)
2:00.216 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(9), focused_energy(10)
2:01.376 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8), focused_energy(10)
2:02.511 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), focused_energy(10)
2:03.327 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(6), focused_energy(10)
2:04.293 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), focused_energy(10)
2:05.093 default G use_items Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), focused_energy(10)
2:05.093 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), focused_energy(10), ignition_mages_fuse
2:05.865 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(4), focused_energy(10), ignition_mages_fuse
2:07.019 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), focused_energy(10), ignition_mages_fuse
2:07.936 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), focused_energy(10), ignition_mages_fuse
2:08.851 default N moonfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, focused_energy(10), ignition_mages_fuse
2:09.907 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.203 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.500 default M sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.518 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.769 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.750 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.000 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.833 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.637 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.842 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.790 default J starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.822 default O stellar_flare Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:22.790 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.023 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord, focused_energy(10), ignition_mages_fuse(5)
2:24.993 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(5)
2:26.190 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), focused_energy(10)
2:27.153 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), focused_energy(10)
2:28.115 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), starlord(2), focused_energy(10)
2:29.248 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), starlord(2), focused_energy(10)
2:30.381 default M sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
2:31.481 default N moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
2:32.582 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
2:33.985 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), focused_energy(10)
2:34.921 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
2:36.326 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), focused_energy(10)
2:37.263 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), focused_energy(10)
2:38.200 default P lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), focused_energy(10)
2:39.603 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(6), starlord(3), focused_energy(10)
2:40.705 default I cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(6), starlord(3), focused_energy(10)
2:40.705 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(6), focused_energy(10)
2:41.904 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
2:43.068 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
2:44.510 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
2:45.952 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), focused_energy(10)
2:47.085 default O stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
2:48.043 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
2:48.858 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10)
2:49.976 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10)
2:50.857 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), focused_energy(10)
2:51.613 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10)
2:52.742 default M sunfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10)
2:53.766 default N moonfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(20), focused_energy(10)
2:54.793 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10)
2:55.671 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10)
2:56.705 default P lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10)
2:58.026 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10)
2:59.356 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(14), focused_energy(10)
3:00.246 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(13), focused_energy(10)
3:01.140 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), solar_empowerment, overwhelming_power(12), focused_energy(10)
3:02.290 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(11), focused_energy(10)
3:03.716 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, overwhelming_power(10), focused_energy(10)
3:04.673 default H celestial_alignment Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord, overwhelming_power(9), focused_energy(10)
3:05.655 default E potion Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord, overwhelming_power(8), focused_energy(10)
3:05.655 default F berserking Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord, overwhelming_power(8), focused_energy(10), battle_potion_of_intellect
3:05.655 default J starsurge Fluffy_Pillow 85.5/100: 86% astral_power berserking, arcanic_pulsar(3), celestial_alignment, solar_empowerment, starlord, overwhelming_power(8), focused_energy(10), battle_potion_of_intellect
3:06.554 default M sunfire Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), focused_energy(10), battle_potion_of_intellect
3:07.427 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6), focused_energy(10), battle_potion_of_intellect
3:08.304 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), focused_energy(10), battle_potion_of_intellect
3:09.060 default O stellar_flare Fluffy_Pillow 19.0/100: 19% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10), battle_potion_of_intellect
3:09.918 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10), battle_potion_of_intellect
3:10.674 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3), focused_energy(10), battle_potion_of_intellect
3:11.772 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), focused_energy(10), battle_potion_of_intellect
3:12.525 default J starsurge Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power, focused_energy(10), battle_potion_of_intellect
3:13.391 default N moonfire Fluffy_Pillow 17.5/100: 18% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:14.264 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), battle_potion_of_intellect
3:15.018 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10), battle_potion_of_intellect
3:16.044 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10), battle_potion_of_intellect
3:16.853 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), battle_potion_of_intellect
3:17.608 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), focused_energy(10), battle_potion_of_intellect
3:18.640 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), focused_energy(10), battle_potion_of_intellect
3:19.398 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), battle_potion_of_intellect
3:20.540 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10), battle_potion_of_intellect
3:21.442 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), overwhelming_power(17), focused_energy(10), battle_potion_of_intellect
3:22.426 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(16), focused_energy(10), battle_potion_of_intellect
3:23.240 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(15), focused_energy(10), battle_potion_of_intellect
3:24.467 default K sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(14), focused_energy(10), battle_potion_of_intellect
3:25.432 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment(2), starlord, overwhelming_power(13), focused_energy(10), battle_potion_of_intellect
3:26.847 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, overwhelming_power(12), focused_energy(10), battle_potion_of_intellect
3:27.964 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11), focused_energy(10), battle_potion_of_intellect
3:28.771 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(10), focused_energy(10), battle_potion_of_intellect
3:29.982 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(9), focused_energy(10), battle_potion_of_intellect
3:30.938 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), focused_energy(10)
3:31.728 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), focused_energy(10)
3:32.918 default L moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(6), focused_energy(10)
3:33.857 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(5), focused_energy(10)
3:34.936 default O stellar_flare Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), focused_energy(10)
3:35.946 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), focused_energy(10)
3:37.233 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10)
3:38.529 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10)
3:39.395 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(21), focused_energy(10)
3:40.418 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(20), focused_energy(10)
3:41.726 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(2), overwhelming_power(19), focused_energy(10)
3:42.850 default M sunfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), focused_energy(10)
3:43.942 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), focused_energy(10)
3:45.341 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(24), focused_energy(10)
3:46.413 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10)
3:47.743 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10)
3:48.634 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(21), focused_energy(10)
3:49.975 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(20), focused_energy(10)
3:51.030 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10)
3:52.345 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10)
3:53.227 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(16), focused_energy(10)
3:54.112 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(15), focused_energy(10)
3:55.155 default N moonfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), focused_energy(10)
3:56.204 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), focused_energy(10)
3:57.544 default O stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
3:58.599 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10)
3:59.499 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
4:00.561 default M sunfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), focused_energy(10)
4:01.626 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10)
4:02.989 default J starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(6), torrent_of_elements, overwhelming_power(7), focused_energy(10)
4:04.159 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(5), focused_energy(10)
4:05.615 default G use_items Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(4), focused_energy(10)
4:05.615 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(4), focused_energy(10), ignition_mages_fuse
4:06.719 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(3), focused_energy(10), ignition_mages_fuse
4:08.090 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power, focused_energy(10), ignition_mages_fuse
4:09.012 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:09.937 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:11.270 default J starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.316 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.069 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.196 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.050 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.803 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.891 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.645 default K sunfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:18.472 default N moonfire Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.418 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.365 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.571 default O stellar_flare Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.517 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.432 default J starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.430 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.397 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.595 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
4:28.037 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), focused_energy(10)
4:29.170 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

life-force : 39301 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39301.3 39301.3 31.4 / 0.080% 5301.7 / 13.5% 4529.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.1 Astral Power 0.00% 58.6 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
life-force 39301
Azerite Spike 744 1.9% 17.0 17.14sec 13142 0 Direct 16.9 11151 22309 13156 18.0%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 16.94 0.00 0.00 0.0000 0.0000 222798.16 222798.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.89 82.03% 11151.05 10657 12308 11147.40 10701 11874 154918 154918 0.00
crit 3.04 17.97% 22309.34 21313 24617 21321.77 0 24617 67880 67880 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9704.69
  • base_dd_max:9704.69
  • base_dd_mult:1.00
 
Heed My Call 307 (438) 0.8% (1.1%) 8.3 32.92sec 15732 0 Direct 8.3 9323 18655 11017 18.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.0000 0.0000 91753.04 91753.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.82 81.84% 9322.87 8901 10280 9318.05 0 10280 63545 63545 0.00
crit 1.51 18.16% 18654.76 17802 20561 14575.29 0 20561 28208 28208 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 131 0.3% 8.3 32.92sec 4715 0 Direct 8.3 3996 7986 4715 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.0000 0.0000 39268.40 39268.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.83 81.99% 3996.47 3815 4406 3995.92 0 4406 27288 27288 0.00
crit 1.50 18.01% 7986.24 7629 8812 6271.79 0 8812 11981 11981 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5219 13.3% 77.9 3.75sec 20038 15530 Direct 77.9 16994 33974 20038 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.94 77.94 0.00 0.00 1.2903 0.0000 1561754.50 1561754.50 0.00 15530.11 15530.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.96 82.07% 16993.57 8882 22316 17003.00 16382 17974 1086987 1086987 0.00
crit 13.97 17.93% 33974.17 17765 44632 33991.88 30454 39763 474767 474767 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2571 6.6% 14.0 21.38sec 54871 54482 Direct 14.0 2918 5839 3437 17.8%  
Periodic 225.9 2706 5407 3192 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.02 14.02 225.86 225.86 1.0071 1.3127 769124.96 769124.96 0.00 2476.22 54482.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.53 82.23% 2917.88 2589 3743 2920.11 2627 3271 33634 33634 0.00
crit 2.49 17.77% 5838.68 5177 7486 5444.63 0 7486 14539 14539 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.2 82.00% 2705.88 2 3485 2707.54 2623 2831 501155 501155 0.00
crit 40.7 18.00% 5406.54 3 6970 5409.52 5064 6020 219798 219798 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 834 2.1% 45.0 6.49sec 5540 0 Direct 45.0 4696 9387 5540 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.05 45.05 0.00 0.00 0.0000 0.0000 249561.73 249561.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.94 82.01% 4695.84 4180 6044 4698.64 4368 5133 173471 173471 0.00
crit 8.11 17.99% 9386.98 8360 12088 9388.17 0 12088 76090 76090 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2953 (4654) 7.5% (11.9%) 94.9 3.09sec 14676 16320 Direct 95.4 7851 15688 9259 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.89 95.41 0.00 0.00 0.8993 0.0000 883479.94 883479.94 0.00 16319.87 16319.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.26 82.02% 7850.59 6967 10073 7856.75 7525 8373 614410 614410 0.00
crit 17.15 17.98% 15688.42 13933 20147 15700.61 14165 18115 269070 269070 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1702 4.3% 75.1 3.89sec 6778 0 Direct 75.1 6778 0 6778 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.11 75.11 0.00 0.00 0.0000 0.0000 509111.08 509111.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.11 100.00% 6778.16 5086 14707 6782.97 5915 8006 509111 509111 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10171.21
  • base_dd_max:10171.21
  • base_dd_mult:1.00
 
Starsurge 12286 31.3% 61.9 4.87sec 59412 57214 Direct 61.7 50527 101040 59601 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.85 61.66 0.00 0.00 1.0384 0.0000 3674822.04 3674822.04 0.00 57214.37 57214.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.58 82.04% 50526.60 45067 64694 50554.77 48487 53967 2555652 2555652 0.00
crit 11.08 17.96% 101040.25 90135 129389 101084.87 90135 120420 1119170 1119170 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1668 4.2% 12.7 23.57sec 39150 38449 Direct 12.7 2487 4977 2927 17.7%  
Periodic 223.4 1753 3503 2066 17.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 223.43 223.43 1.0182 1.3159 498958.10 498958.10 0.00 1625.31 38449.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.50 82.35% 2487.34 2231 3227 2488.41 2231 2763 26105 26105 0.00
crit 2.25 17.65% 4977.38 4463 6453 4528.49 0 6453 11197 11197 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.4 82.09% 1752.84 2 2259 1753.90 1697 1836 321496 321496 0.00
crit 40.0 17.91% 3502.63 50 4517 3504.68 3268 3832 140159 140159 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6214 15.7% 92.5 3.01sec 19985 0 Direct 92.5 16956 33912 19984 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.51 92.51 0.00 0.00 0.0000 0.0000 1848787.42 1848787.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.99 82.14% 16956.02 15985 18463 16956.98 16406 17837 1288431 1288431 0.00
crit 16.52 17.86% 33911.52 31970 36925 33911.60 32406 36674 560356 560356 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2862 7.3% 17.9 16.62sec 47764 47151 Direct 17.9 4023 8054 4743 17.9%  
Periodic 225.0 2906 5806 3427 18.0% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 224.99 224.99 1.0130 1.3138 856165.20 856165.20 0.00 2728.90 47150.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.72 82.14% 4023.12 3570 5163 4024.12 3720 4432 59237 59237 0.00
crit 3.20 17.86% 8053.51 7141 10325 7795.11 0 10325 25779 25779 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.5 82.02% 2906.09 6 3743 2907.87 2818 3037 536243 536243 0.00
crit 40.5 17.98% 5805.66 36 7486 5808.42 5345 6317 234906 234906 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
pet - guardian_of_azeroth 8920 / 1810
Azerite Spike 7902 4.0% 58.2 3.64sec 8146 8067 Direct 58.2 6927 13853 8146 17.6%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.21 58.21 0.00 0.00 1.0098 0.0000 474146.25 474146.25 0.00 8066.73 8066.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.96 82.40% 6926.52 6927 6927 6926.52 6927 6927 332206 332206 0.00
crit 10.25 17.60% 13853.04 13853 13853 13853.04 13853 13853 141941 141941 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6308.05
  • base_dd_max:6308.05
  • base_dd_mult:1.00
 
Azerite Volley 1017 0.5% 6.0 39.27sec 10173 0 Direct 6.0 8658 17316 10173 17.5%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 61040.40 61040.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.95 82.50% 8658.15 8658 8658 8658.15 8658 8658 42857 42857 0.00
crit 1.05 17.50% 17316.29 17316 17316 11817.14 0 17316 18183 18183 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7884.76
  • base_dd_max:7884.76
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
life-force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.55sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.46sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8529 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 0.00sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.1814 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.4 43.6sec 4.9sec 92.68% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.83%
  • arcanic_pulsar_2:11.05%
  • arcanic_pulsar_3:10.87%
  • arcanic_pulsar_4:10.58%
  • arcanic_pulsar_5:13.46%
  • arcanic_pulsar_6:11.08%
  • arcanic_pulsar_7:10.60%
  • arcanic_pulsar_8:13.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.3sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.12% 12.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.8sec 37.8sec 26.06% 33.69% 0.0(0.0) 8.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.5sec 23.73% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Guardian of Azeroth 2.0 56.2 180.2sec 3.6sec 19.23% 0.00% 48.2(48.2) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:0.91%
  • guardian_of_azeroth_2:0.90%
  • guardian_of_azeroth_3:0.88%
  • guardian_of_azeroth_4:0.79%
  • guardian_of_azeroth_5:15.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.23% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:life-force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.8 46.3 8.7sec 3.7sec 81.93% 99.68% 2.0(2.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.48%
  • lunar_empowerment_2:31.13%
  • lunar_empowerment_3:14.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.6 64.3sec 33.4sec 48.38% 0.00% 3.6(50.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.06%
  • overwhelming_power_16:2.12%
  • overwhelming_power_17:2.19%
  • overwhelming_power_18:2.25%
  • overwhelming_power_19:2.32%
  • overwhelming_power_20:2.39%
  • overwhelming_power_21:2.47%
  • overwhelming_power_22:2.54%
  • overwhelming_power_23:2.62%
  • overwhelming_power_24:2.70%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.4 52.0 11.7sec 3.9sec 84.95% 78.85% 0.2(0.2) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.59%
  • solar_empowerment_2:39.19%
  • solar_empowerment_3:17.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 46.6 20.2sec 4.9sec 97.33% 93.69% 16.6(16.6) 11.3

Buff details

  • buff initial source:life-force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.34%
  • starlord_2:22.45%
  • starlord_3:60.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.6sec 23.69% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.69%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:life-force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:life-force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
life-force
starsurge Astral Power 61.9 2474.1 40.0 40.0 1485.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.89 767.02 (31.48%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
sunfire Astral Power 17.92 53.77 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.05 180.18 (7.39%) 4.00 0.00 0.00%
moonfire Astral Power 14.02 42.05 (1.73%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.75 101.96 (4.18%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.94 935.20 (38.38%) 12.00 0.08 0.01%
natures_balance Astral Power 400.03 200.02 (8.21%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.37 76.44 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.13 8.26
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.21 0.00 63.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data life-force Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data life-force Damage Per Second
Count 7592
Mean 39301.32
Minimum 35495.82
Maximum 44026.99
Spread ( max - min ) 8531.17
Range [ ( max - min ) / 2 * 100% ] 10.85%
Standard Deviation 1395.8717
5th Percentile 37138.47
95th Percentile 41708.36
( 95th Percentile - 5th Percentile ) 4569.88
Mean Distribution
Standard Deviation 16.0202
95.00% Confidence Intervall ( 39269.92 - 39332.72 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4846
0.1 Scale Factor Error with Delta=300 16634
0.05 Scale Factor Error with Delta=300 66533
0.01 Scale Factor Error with Delta=300 1663316
Priority Target DPS
Sample Data life-force Priority Target Damage Per Second
Count 7592
Mean 39301.32
Minimum 35495.82
Maximum 44026.99
Spread ( max - min ) 8531.17
Range [ ( max - min ) / 2 * 100% ] 10.85%
Standard Deviation 1395.8717
5th Percentile 37138.47
95th Percentile 41708.36
( 95th Percentile - 5th Percentile ) 4569.88
Mean Distribution
Standard Deviation 16.0202
95.00% Confidence Intervall ( 39269.92 - 39332.72 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4846
0.1 Scale Factor Error with Delta=300 16634
0.05 Scale Factor Error with Delta=300 66533
0.01 Scale Factor Error with Delta=300 1663316
DPS(e)
Sample Data life-force Damage Per Second (Effective)
Count 7592
Mean 39301.32
Minimum 35495.82
Maximum 44026.99
Spread ( max - min ) 8531.17
Range [ ( max - min ) / 2 * 100% ] 10.85%
Damage
Sample Data life-force Damage
Count 7592
Mean 11205584.58
Minimum 8700789.15
Maximum 13806761.74
Spread ( max - min ) 5105972.60
Range [ ( max - min ) / 2 * 100% ] 22.78%
DTPS
Sample Data life-force Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data life-force Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data life-force Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data life-force Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data life-force Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data life-force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data life-forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data life-force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
H 2.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.92 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.85 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.98 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.85 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.44 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.16 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 78.30 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 95.14 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.50 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQKRQRQNRORQRJKRKPRLQKQQQRRRKRQKRQRJKQKOQNQKPRQRKRQQQRKNORKRQQKPRQQRRRJKNKRKRQOQKQRQRKPQNRKQRRRKOQRRKQRNRQPKQRKRGRQKRMQQKNQRRRRKQKPQQRKQONQRKQRQRKQRRKPQNRKORQRQRRHKKQQNRIEFKPKRQORKRQRQRQKRKRQRKLQQRRPROQRJKRKRKRLQKQQQKRQOPQKNRQGRKQRRRKQRRRRRNOKPKRQRKRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask life-force 58.0/100: 58% astral_power
Pre precombat 1 food life-force 58.0/100: 58% astral_power
Pre precombat 2 augmentation life-force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H guardian_of_azeroth Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.250 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.211 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.127 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, guardian_of_azeroth(2), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.026 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, guardian_of_azeroth(2), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.925 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.691 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.691 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.691 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, guardian_of_azeroth(4), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.445 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.200 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.952 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.708 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.482 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.236 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.990 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.745 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.499 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.252 default R solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.008 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.762 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.516 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.270 default N sunfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.024 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.777 default O moonfire Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.533 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.290 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.050 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.804 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.804 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.558 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.312 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.067 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:23.822 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:24.576 default L sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:25.331 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:26.197 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(2), starlord(2), torrent_of_elements
0:27.021 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
0:28.042 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:29.063 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
0:30.086 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
0:30.839 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
0:31.593 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements
0:32.477 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), starlord(3)
0:33.360 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
0:34.115 default Q lunar_strike Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
0:35.093 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:35.861 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
0:36.614 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
0:37.592 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:38.361 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:38.361 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), torrent_of_elements
0:39.198 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements
0:40.389 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements
0:41.322 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:42.501 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
0:44.002 default N sunfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
0:45.178 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
0:46.678 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
0:47.856 default P stellar_flare Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
0:49.002 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:49.974 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:51.432 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
0:52.406 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
0:53.551 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:54.524 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:55.983 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:57.442 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
0:58.902 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(5), solar_empowerment(3)
0:59.965 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(5), solar_empowerment(2)
1:01.214 default N sunfire Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord
1:02.428 default O moonfire Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord
1:03.641 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord
1:04.670 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
1:05.883 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
1:06.885 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2)
1:08.384 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:09.884 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:11.061 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:12.207 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:13.180 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:14.640 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:16.099 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:17.071 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:18.044 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(8), starlord(3)
1:19.188 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), starlord(3)
1:19.188 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8)
1:20.436 default N sunfire Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24)
1:21.403 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23)
1:22.371 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22)
1:23.175 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(21)
1:24.125 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(20)
1:24.912 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20)
1:26.092 default O moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18)
1:27.163 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24)
1:28.500 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23)
1:29.553 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22)
1:30.900 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21)
1:31.803 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
1:33.160 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(18)
1:34.071 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(17)
1:35.148 default P stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
1:36.229 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
1:37.612 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(14)
1:38.700 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(13)
1:39.629 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment, overwhelming_power(12)
1:40.824 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(11)
1:42.305 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(9)
1:43.301 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(8)
1:44.303 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), starlord, overwhelming_power(7)
1:45.484 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), starlord, overwhelming_power(6)
1:46.670 default O moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(5)
1:47.825 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(4)
1:49.302 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(2)
1:50.297 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power
1:51.294 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), starlord(2)
1:52.470 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
1:53.928 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:54.902 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), starlord(3)
1:56.049 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), starlord(3)
1:57.195 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3)
1:58.654 default P stellar_flare Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:59.799 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(7), solar_empowerment
2:01.048 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord
2:02.593 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord
2:03.625 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), solar_empowerment, starlord, conch_of_dark_whispers
2:04.837 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:05.709 default G use_items Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
2:05.709 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:06.546 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:07.796 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, lunar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:08.778 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:09.591 default M moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:10.547 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.891 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.236 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.294 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.311 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.606 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.471 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.336 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.315 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), starlord(3), ignition_mages_fuse(4)
2:20.295 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment, ignition_mages_fuse(4)
2:21.360 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, ignition_mages_fuse(4)
2:22.682 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), ignition_mages_fuse(5)
2:23.613 default P stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), ignition_mages_fuse(5)
2:24.520 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), ignition_mages_fuse(5)
2:25.680 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), ignition_mages_fuse(5)
2:26.845 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(20)
2:27.778 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(19)
2:28.877 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
2:30.244 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
2:31.325 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
2:32.408 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
2:33.795 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(13)
2:34.724 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(12)
2:35.821 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
2:37.221 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
2:38.164 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers
2:39.580 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(7), conch_of_dark_whispers
2:40.529 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), overwhelming_power(6), conch_of_dark_whispers
2:41.750 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), conch_of_dark_whispers
2:43.266 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(3), conch_of_dark_whispers
2:44.285 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), starlord, overwhelming_power(2), conch_of_dark_whispers
2:45.489 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), starlord, overwhelming_power, conch_of_dark_whispers
2:46.697 default P stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
2:47.874 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
2:49.374 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
2:50.551 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
2:51.551 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements
2:52.729 default O moonfire Fluffy_Pillow 14.0/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
2:53.726 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
2:54.573 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
2:55.844 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, starlord(3), torrent_of_elements
2:56.840 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, starlord(3), torrent_of_elements
2:58.337 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power starlord(3), torrent_of_elements, conch_of_dark_whispers
2:59.484 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power starlord(3), torrent_of_elements, conch_of_dark_whispers
3:00.629 default H guardian_of_azeroth Fluffy_Pillow 78.0/100: 78% astral_power torrent_of_elements, conch_of_dark_whispers
3:01.878 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power torrent_of_elements, conch_of_dark_whispers
3:03.127 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power guardian_of_azeroth, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
3:04.315 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power guardian_of_azeroth(2), arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:05.759 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power guardian_of_azeroth(3), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
3:07.176 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power guardian_of_azeroth(4), arcanic_pulsar(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
3:08.266 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power guardian_of_azeroth(4), arcanic_pulsar(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
3:09.193 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
3:10.125 default E potion Fluffy_Pillow 87.5/100: 88% astral_power guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
3:10.125 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:10.125 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:10.972 default P stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:11.795 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:12.619 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:13.375 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:14.424 default O moonfire Fluffy_Pillow 38.5/100: 39% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:15.247 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:16.001 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:16.826 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:17.580 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:18.629 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:19.384 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:20.433 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:21.188 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:22.237 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, solar_empowerment, battle_potion_of_intellect
3:23.224 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:24.039 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:25.000 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:25.793 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:26.980 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect
3:27.774 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(2), battle_potion_of_intellect
3:28.707 default L sunfire Fluffy_Pillow 7.0/100: 7% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:29.613 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:30.940 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:32.401 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:33.374 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), battle_potion_of_intellect
3:34.348 default P stellar_flare Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), starlord(3), battle_potion_of_intellect
3:35.493 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), starlord(3)
3:36.639 default O moonfire Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
3:37.784 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
3:39.243 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
3:40.388 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
3:40.388 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar(8), conch_of_dark_whispers
3:41.636 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
3:42.532 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power celestial_alignment, lunar_empowerment, starlord, conch_of_dark_whispers
3:43.585 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
3:44.456 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
3:45.480 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:46.328 default L sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:47.322 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:48.780 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:49.924 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:51.384 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:52.845 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:54.304 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:55.448 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25)
3:56.336 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
3:57.674 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
3:58.730 default P stellar_flare Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
3:59.787 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
4:01.139 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), solar_empowerment(2), torrent_of_elements, overwhelming_power(19)
4:02.304 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(18)
4:03.438 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(17)
4:04.406 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(16)
4:05.863 default G use_items Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(15)
4:05.863 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(15), ignition_mages_fuse
4:06.801 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(14), ignition_mages_fuse
4:07.908 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13), ignition_mages_fuse
4:09.284 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), ignition_mages_fuse
4:10.206 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(2)
4:11.099 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(2)
4:12.153 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(2)
4:13.210 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), ignition_mages_fuse(2)
4:14.524 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), ignition_mages_fuse(3)
4:15.370 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(5), ignition_mages_fuse(3)
4:16.371 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(4), ignition_mages_fuse(3)
4:17.374 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(3), ignition_mages_fuse(3)
4:18.379 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(2), ignition_mages_fuse(4)
4:19.354 default N sunfire Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power, ignition_mages_fuse(4)
4:20.331 default O moonfire Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
4:21.312 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(7), torrent_of_elements, ignition_mages_fuse(4)
4:22.380 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(5)
4:23.379 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(5)
4:24.380 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
4:25.134 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
4:26.212 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
4:27.084 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
4:28.109 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:28.956 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="life-force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

lucid dreams : 38023 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
38022.6 38022.6 28.1 / 0.074% 4836.2 / 12.7% 3940.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.6 9.5 Astral Power 0.00% 59.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 38023
Heed My Call 296 (423) 0.8% (1.1%) 8.2 33.03sec 15498 0 Direct 8.2 9203 18380 10847 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 88598.39 88598.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.08% 9202.52 8901 10180 9201.82 0 10180 61702 61702 0.00
crit 1.46 17.92% 18379.54 17802 20359 14117.35 0 20359 26897 26897 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 127 0.3% 8.2 33.03sec 4651 0 Direct 8.2 3943 7882 4651 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 37992.78 37992.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.03% 3943.36 3815 4363 3943.81 3815 4363 26422 26422 0.00
crit 1.47 17.97% 7882.26 7629 8725 6152.93 0 8725 11571 11571 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5025 13.2% 76.2 3.83sec 19752 15022 Direct 76.2 16746 33480 19752 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.19 76.19 0.00 0.00 1.3149 0.0000 1504893.61 1504893.61 0.00 15021.60 15021.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.50 82.03% 16745.91 8882 22097 16753.66 16021 17572 1046630 1046630 0.00
crit 13.69 17.97% 33479.62 20430 44195 33496.03 30866 38109 458264 458264 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2495 6.6% 14.2 21.26sec 52717 51689 Direct 14.2 2859 5717 3366 17.8%  
Periodic 222.2 2667 5330 3145 18.0% 99.2%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.16 14.16 222.25 222.25 1.0199 1.3376 746644.08 746644.08 0.00 2395.25 51688.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.65 82.24% 2858.81 2589 3706 2860.21 2643 3133 33301 33301 0.00
crit 2.51 17.76% 5716.75 5177 7413 5330.22 0 7413 14376 14376 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.3 82.04% 2666.67 2 3451 2668.01 2587 2785 486249 486249 0.00
crit 39.9 17.96% 5330.44 51 6901 5332.60 4915 5861 212718 212718 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 810 2.1% 44.4 6.57sec 5455 0 Direct 44.4 4626 9243 5455 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.41 44.41 0.00 0.00 0.0000 0.0000 242261.26 242261.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.44 82.05% 4625.96 4180 5985 4628.10 4330 5049 168569 168569 0.00
crit 7.97 17.95% 9243.08 8360 11970 9242.43 0 11970 73692 73692 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2592 (4385) 6.8% (11.5%) 84.1 3.48sec 15599 17571 Direct 84.8 7757 15513 9148 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.13 84.80 0.00 0.00 0.8878 0.0000 775728.76 775728.76 0.00 17570.82 17570.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.59 82.06% 7756.77 6967 9975 7761.28 7473 8204 539798 539798 0.00
crit 15.21 17.94% 15512.87 13933 19950 15519.58 14002 17715 235931 235931 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1793 4.7% 80.1 3.64sec 6696 0 Direct 80.1 6696 0 6696 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.14 80.14 0.00 0.00 0.0000 0.0000 536636.15 536636.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.14 100.00% 6696.29 5086 14563 6700.00 5722 7796 536636 536636 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 14146 37.2% 72.1 4.20sec 58669 56587 Direct 71.8 49984 99907 58921 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.11 71.81 0.00 0.00 1.0368 0.0000 4230831.06 4230831.06 0.00 56586.88 56586.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.95 82.10% 49983.77 45067 64060 50004.51 48181 52548 2946694 2946694 0.00
crit 12.85 17.90% 99906.72 90135 128121 99937.70 90135 113845 1284137 1284137 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1622 4.3% 12.8 23.58sec 38004 36869 Direct 12.8 2445 4895 2876 17.6%  
Periodic 220.0 1729 3455 2039 18.0% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.77 12.77 220.03 220.03 1.0308 1.3396 485375.97 485375.97 0.00 1576.33 36868.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.52 82.40% 2445.21 2231 3195 2446.22 2246 2674 25733 25733 0.00
crit 2.25 17.60% 4895.40 4463 6390 4454.38 0 6390 11003 11003 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.5 82.03% 1728.73 7 2237 1729.60 1676 1804 312022 312022 0.00
crit 39.5 17.97% 3455.38 136 4473 3456.76 3238 3816 136617 136617 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6346 16.6% 96.7 2.91sec 19531 0 Direct 96.7 16564 33121 19531 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.75 96.75 0.00 0.00 0.0000 0.0000 1889595.53 1889595.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.41 82.08% 16563.77 15985 18282 16563.26 16017 17432 1315295 1315295 0.00
crit 17.34 17.92% 33120.78 31970 36563 33119.34 31970 35348 574300 574300 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2770 7.3% 17.4 17.17sec 47554 46612 Direct 17.4 3970 7938 4676 17.8%  
Periodic 221.4 2862 5722 3376 17.9% 98.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.43 17.43 221.40 221.40 1.0202 1.3386 828853.15 828853.15 0.00 2638.42 46611.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.33 82.20% 3969.68 3570 5112 3971.09 3680 4332 56875 56875 0.00
crit 3.10 17.80% 7938.16 7141 10224 7664.69 0 10224 24627 24627 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.7 82.06% 2862.48 2 3706 2863.89 2784 2976 520028 520028 0.00
crit 39.7 17.94% 5722.36 7 7413 5724.82 5369 6247 227323 227323 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.03sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 185.09sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8641 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Memory of Lucid Dreams 2.9 123.10sec

Stats details: memory_of_lucid_dreams

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.0154 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: memory_of_lucid_dreams

Static Values
  • id:298357
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
Spelldata
  • id:298357
  • name:Memory of Lucid Dreams
  • school:physical
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 8.4 63.4 37.7sec 4.2sec 92.32% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.89%
  • arcanic_pulsar_2:12.21%
  • arcanic_pulsar_3:11.86%
  • arcanic_pulsar_4:11.19%
  • arcanic_pulsar_5:11.08%
  • arcanic_pulsar_6:11.56%
  • arcanic_pulsar_7:11.67%
  • arcanic_pulsar_8:11.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 191.8sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.9sec 181.9sec 8.12% 8.22% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.5sec 37.5sec 28.32% 35.68% 0.0(0.0) 8.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.7sec 45.3sec 23.75% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.15% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 8.2 2.5 35.0sec 26.3sec 25.05% 0.00% 2.5(2.5) 8.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:353.31

Stack Uptimes

  • lucid_dreams_1:25.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 16.4 72.6 17.9sec 3.4sec 93.66% 99.98% 10.7(10.7) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:20.15%
  • lunar_empowerment_2:42.80%
  • lunar_empowerment_3:30.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Memory of Lucid Dreams 2.9 0.0 123.0sec 123.0sec 14.27% 16.58% 0.0(0.0) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_memory_of_lucid_dreams
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:leech_rating
  • amount:0.00

Stack Uptimes

  • memory_of_lucid_dreams_1:14.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298357
  • name:Memory of Lucid Dreams
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.5 64.3sec 33.8sec 47.78% 0.00% 3.5(48.2) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 9.0 78.3 28.6sec 3.5sec 96.57% 94.54% 4.3(4.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:13.20%
  • solar_empowerment_2:47.34%
  • solar_empowerment_3:36.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.8 56.4 19.6sec 4.2sec 98.35% 93.13% 25.2(25.2) 7.5

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.44%
  • starlord_2:21.62%
  • starlord_3:61.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.1sec 46.0sec 23.52% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.52%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 72.1 2884.5 40.0 40.0 1466.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 85.13 790.22 (27.71%) 9.28 0.45 0.06%
celestial_alignment Astral Power 2.00 118.22 (4.15%) 59.11 1.78 1.48%
sunfire Astral Power 17.43 58.97 (2.07%) 3.38 0.00 0.00%
shooting_stars Astral Power 44.41 207.75 (7.29%) 4.68 0.24 0.11%
moonfire Astral Power 14.16 47.29 (1.66%) 3.34 0.00 0.00%
stellar_flare Astral Power 12.77 113.24 (3.97%) 8.87 0.05 0.04%
lunar_strike Astral Power 76.19 1011.04 (35.46%) 13.27 6.66 0.65%
lucid_dreams Astral Power 10.73 214.61 (7.53%) 20.00 0.00 0.00%
natures_balance Astral Power 400.03 199.85 (7.01%) 0.50 0.16 0.08%
arcanic_pulsar Astral Power 7.51 90.17 (3.16%) 12.00 0.01 0.01%
Resource RPS-Gain RPS-Loss
Astral Power 9.52 9.63
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 24.83 0.00 81.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data lucid dreams Damage Per Second
Count 7592
Mean 38022.55
Minimum 33999.36
Maximum 42426.63
Spread ( max - min ) 8427.28
Range [ ( max - min ) / 2 * 100% ] 11.08%
Standard Deviation 1251.2342
5th Percentile 36011.33
95th Percentile 40109.38
( 95th Percentile - 5th Percentile ) 4098.05
Mean Distribution
Standard Deviation 14.3602
95.00% Confidence Intervall ( 37994.41 - 38050.70 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4160
0.1 Scale Factor Error with Delta=300 13365
0.05 Scale Factor Error with Delta=300 53460
0.01 Scale Factor Error with Delta=300 1336476
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 7592
Mean 38022.55
Minimum 33999.36
Maximum 42426.63
Spread ( max - min ) 8427.28
Range [ ( max - min ) / 2 * 100% ] 11.08%
Standard Deviation 1251.2342
5th Percentile 36011.33
95th Percentile 40109.38
( 95th Percentile - 5th Percentile ) 4098.05
Mean Distribution
Standard Deviation 14.3602
95.00% Confidence Intervall ( 37994.41 - 38050.70 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4160
0.1 Scale Factor Error with Delta=300 13365
0.05 Scale Factor Error with Delta=300 53460
0.01 Scale Factor Error with Delta=300 1336476
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 7592
Mean 38022.55
Minimum 33999.36
Maximum 42426.63
Spread ( max - min ) 8427.28
Range [ ( max - min ) / 2 * 100% ] 11.08%
Damage
Sample Data lucid dreams Damage
Count 7592
Mean 11367410.74
Minimum 8789796.22
Maximum 14197173.26
Spread ( max - min ) 5407377.03
Range [ ( max - min ) / 2 * 100% ] 23.78%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
H 2.87 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
I 2.00 celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 7.26 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 72.11 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.10 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.50 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 13.99 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.66 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.77 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.37 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 84.37 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.34 sunfire

Sample Sequence

0123456789ACDKKONPHIFGKRKRQKRQKRQKNRJKORKRQPKRQRKRQRKRQKQQNQJKRKRQOQKRQKPRQRQNRJKRKRQRKORQRQKRNPQRQKRKRQKROQKRNQQRRPRKQKRQKRQLOKRQRRRRRKPQKQQNKGROHQRQJKKRQKRQNPRRKRQKRQMQJKQKRQKNRQQKPRQRRORKQKNRQQKRQRQIEFKPRQJKORNRKRQKRQKRQRKRQRQRQKNOPQKRQKRQQRRQNRKRKRPRMKQQKGRQRKNHRQKKRQKOPRKRQKKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, lucid_dreams, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.182 default O moonfire Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:03.091 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:03.997 default P stellar_flare Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:04.905 default H memory_of_lucid_dreams Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:05.813 default I celestial_alignment Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.604 default F berserking Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.604 default G use_items Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.604 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.359 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.114 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.868 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.623 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.475 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.229 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.983 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.804 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.558 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.314 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.133 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.886 default N sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.642 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.398 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.398 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.152 default O moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.906 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.661 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.418 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.172 default Q lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.033 default P stellar_flare Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.785 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.540 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
0:24.295 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
0:25.101 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
0:25.853 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(5)
0:26.610 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25)
0:27.365 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24)
0:28.260 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:29.015 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22)
0:29.769 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22)
0:30.524 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21)
0:31.431 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20)
0:32.184 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19)
0:33.231 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
0:34.284 default N sunfire Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
0:35.115 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
0:36.175 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(15)
0:36.175 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, lucid_dreams, arcanic_pulsar(4), solar_empowerment(2), overwhelming_power(15)
0:37.085 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(14)
0:37.842 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(14)
0:38.730 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(13)
0:39.484 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(12)
0:40.589 default O moonfire Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11)
0:41.459 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
0:42.904 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9)
0:44.043 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7)
0:44.992 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7)
0:46.415 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25)
0:47.462 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24)
0:48.513 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23)
0:49.409 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22)
0:50.754 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21)
0:51.656 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
0:53.013 default N sunfire Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(18)
0:54.085 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(17)
0:55.000 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(16)
0:55.000 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), solar_empowerment(2), overwhelming_power(16)
0:56.177 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(15)
0:57.024 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(14)
0:58.026 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(13)
0:58.855 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13)
1:00.101 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(11)
1:00.939 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11)
1:01.923 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10)
1:03.026 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8)
1:03.973 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8)
1:05.388 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6)
1:06.342 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5)
1:07.773 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
1:08.900 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3)
1:09.863 default N sunfire Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2)
1:11.002 default P stellar_flare Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:12.148 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:13.608 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3)
1:14.579 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:16.038 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(3), solar_empowerment(2)
1:17.287 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord
1:18.318 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(24)
1:19.428 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(23)
1:20.349 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22)
1:21.736 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21)
1:22.826 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
1:23.732 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:24.803 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18)
1:26.170 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
1:27.251 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15), conch_of_dark_whispers
1:28.175 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers
1:29.265 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
1:30.658 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
1:32.053 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
1:32.993 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(10), conch_of_dark_whispers
1:33.934 default P stellar_flare Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(9), conch_of_dark_whispers
1:35.042 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(7), conch_of_dark_whispers
1:36.156 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(7), overwhelming_power(6), conch_of_dark_whispers
1:37.378 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), conch_of_dark_whispers
1:38.895 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(4), conch_of_dark_whispers
1:40.091 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), conch_of_dark_whispers
1:40.957 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(2), conch_of_dark_whispers
1:42.251 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, solar_empowerment, starlord(2), conch_of_dark_whispers
1:43.276 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:44.123 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:45.390 default L sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:46.385 default O moonfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:47.529 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3)
1:48.676 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3)
1:49.651 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
1:51.112 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
1:52.084 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
1:53.056 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), starlord(3)
1:54.202 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), starlord(3)
1:55.348 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(2), starlord(3)
1:56.494 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment
1:57.741 default P stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord
1:58.953 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord
2:00.496 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord
2:01.708 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:03.209 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
2:04.709 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
2:05.886 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2)
2:07.063 default G use_items Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3)
2:07.063 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse
2:07.997 default O moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
2:09.097 default H memory_of_lucid_dreams Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
2:10.196 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
2:11.595 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:12.495 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:13.840 default J cancel_buff Fluffy_Pillow 82.0/100: 82% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:13.840 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), solar_empowerment, ignition_mages_fuse(2)
2:14.992 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse(2)
2:16.110 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse(3)
2:16.998 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
2:18.329 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
2:19.375 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
2:20.207 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:21.456 default N sunfire Fluffy_Pillow 55.0/100: 55% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:22.434 default P stellar_flare Fluffy_Pillow 61.5/100: 62% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
2:23.412 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
2:24.215 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(5)
2:25.020 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), ignition_mages_fuse(5)
2:25.967 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(5)
2:26.721 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), ignition_mages_fuse(5)
2:27.769 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
2:28.765 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
2:29.613 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
2:30.883 default M moonfire Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
2:31.880 default Q lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
2:33.340 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
2:33.340 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, conch_of_dark_whispers
2:34.588 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
2:36.132 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers
2:37.342 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:38.344 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:39.845 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:41.023 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:42.170 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
2:43.065 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
2:44.408 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
2:45.756 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
2:46.817 default P stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20)
2:47.882 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19)
2:48.792 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
2:50.159 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(16)
2:51.077 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(15)
2:52.000 default O moonfire Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(14)
2:53.090 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(13)
2:54.183 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(5), overwhelming_power(12), conch_of_dark_whispers
2:55.378 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), conch_of_dark_whispers
2:56.861 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(10), conch_of_dark_whispers
2:58.029 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(8), conch_of_dark_whispers
2:59.174 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(24), conch_of_dark_whispers
3:00.090 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers
3:01.459 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), conch_of_dark_whispers
3:02.833 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(23), conch_of_dark_whispers
3:03.915 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
3:04.814 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
3:06.167 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
3:07.076 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
3:08.442 default I celestial_alignment Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
3:09.378 default E potion Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
3:09.378 default F berserking Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect
3:09.378 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power berserking, arcanic_pulsar(8), celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect
3:10.233 default P stellar_flare Fluffy_Pillow 65.5/100: 66% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), battle_potion_of_intellect
3:11.093 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect
3:11.846 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect
3:12.902 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power berserking, celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect
3:12.902 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power berserking, celestial_alignment, solar_empowerment(2), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect
3:13.808 default O moonfire Fluffy_Pillow 60.0/100: 60% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect
3:14.690 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect
3:15.445 default N sunfire Fluffy_Pillow 72.0/100: 72% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:16.332 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect
3:17.089 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect
3:17.984 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(19), battle_potion_of_intellect
3:18.738 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(18), battle_potion_of_intellect
3:19.850 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17), battle_potion_of_intellect
3:20.725 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect
3:21.478 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), battle_potion_of_intellect
3:22.681 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), battle_potion_of_intellect
3:23.628 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect
3:24.437 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:25.652 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:26.465 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:27.425 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:28.245 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:29.479 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:30.451 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:31.692 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:32.671 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:33.922 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, overwhelming_power(3), battle_potion_of_intellect
3:34.997 default N sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(2)
3:36.202 default O moonfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord
3:37.414 default P stellar_flare Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord
3:38.626 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord
3:40.171 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
3:41.383 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:42.383 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:43.883 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
3:45.059 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:46.031 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:47.490 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
3:48.950 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3)
3:49.925 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
3:50.897 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3)
3:52.355 default N sunfire Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
3:53.501 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
3:54.474 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(8), lunar_empowerment
3:55.722 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
3:56.618 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), starlord
3:57.673 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
3:58.544 default P stellar_flare Fluffy_Pillow 69.0/100: 69% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
3:59.570 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
4:00.595 default M moonfire Fluffy_Pillow 86.0/100: 86% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
4:01.618 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power lucid_dreams, arcanic_pulsar, lunar_empowerment(3), starlord(2)
4:02.794 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
4:04.254 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
4:05.714 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:06.859 default G use_items Fluffy_Pillow 65.5/100: 66% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
4:06.859 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
4:07.794 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
4:09.194 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
4:10.126 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
4:11.227 default N sunfire Fluffy_Pillow 56.0/100: 56% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:12.283 default H memory_of_lucid_dreams Fluffy_Pillow 60.0/100: 60% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:13.341 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:14.240 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power memory_of_lucid_dreams, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
4:15.586 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power memory_of_lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), torrent_of_elements, ignition_mages_fuse(3)
4:16.691 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(3), starlord, ignition_mages_fuse(3)
4:17.768 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(3), starlord(2), ignition_mages_fuse(3)
4:18.655 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
4:19.988 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(4)
4:20.997 default O moonfire Fluffy_Pillow 43.5/100: 44% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.976 default P stellar_flare Fluffy_Pillow 50.5/100: 51% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.954 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.758 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.703 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.505 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.710 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.657 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
4:28.653 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
actions+=/celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

purification protocol : 36024 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36024.2 36024.2 25.3 / 0.070% 4334.3 / 12.0% 4457.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 36024
Heed My Call 292 (418) 0.8% (1.2%) 8.2 33.47sec 15302 0 Direct 8.2 9111 18220 10697 17.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 87366.23 87366.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.75 82.59% 9111.06 8901 9791 9111.49 8901 9791 61464 61464 0.00
crit 1.42 17.41% 18220.39 17802 19582 13978.33 0 19582 25902 25902 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 126 0.3% 8.2 33.47sec 4605 0 Direct 8.2 3905 7811 4605 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 37613.25 37613.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.06% 3904.53 3815 4196 3905.00 3815 4196 26171 26171 0.00
crit 1.46 17.94% 7810.64 7629 8392 6062.27 0 8392 11442 11442 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 4966 13.8% 75.9 3.85sec 19574 14953 Direct 75.9 16593 33179 19574 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.94 75.94 0.00 0.00 1.3091 0.0000 1486502.76 1486502.76 0.00 14952.95 14952.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.29 82.03% 16593.37 8882 21253 16600.48 16048 17476 1033648 1033648 0.00
crit 13.65 17.97% 33179.12 17765 42507 33192.17 29586 40368 452855 452855 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2442 6.8% 14.1 21.33sec 51973 50862 Direct 14.1 2855 5712 3368 18.0%  
Periodic 220.6 2628 5252 3098 17.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 220.58 220.58 1.0219 1.3441 730728.40 730728.40 0.00 2350.76 50861.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 82.04% 2855.30 2589 3565 2856.82 2663 3147 32936 32936 0.00
crit 2.52 17.96% 5711.55 5177 7129 5340.58 0 7129 14419 14419 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 82.09% 2628.33 2 3319 2629.58 2555 2733 475943 475943 0.00
crit 39.5 17.91% 5251.76 38 6638 5254.01 4934 5760 207430 207430 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 604 1.7% 16.5 17.42sec 10975 0 Direct 16.5 9295 18593 10975 18.1%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.0000 0.0000 180853.95 180853.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.50 81.93% 9295.02 9083 9991 9294.11 9083 9797 125500 125500 0.00
crit 2.98 18.07% 18592.58 18166 19983 17758.21 0 19983 55354 55354 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8271.92
  • base_dd_max:8271.92
  • base_dd_mult:1.00
 
Purifying Blast 0 (677) 0.0% (1.9%) 5.5 60.36sec 37007 32256

Stats details: purifying_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 0.00 0.00 0.00 1.1473 0.0000 0.00 0.00 0.00 32255.65 32255.65
 
 

Action details: purifying_blast

Static Values
  • id:295337
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295337
  • name:Purifying Blast
  • school:physical
  • tooltip:
  • description:Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.
 
    Purifying Blast (purifying_tick) 677 1.9% 37.9 7.63sec 5333 0 Periodic 37.9 4533 9071 5332 17.6% 0.0%

Stats details: purifying_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.92 0.00 0.00 37.92 0.0000 0.0000 202210.69 202210.69 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.2 82.38% 4533.04 4441 4885 4532.86 4441 4839 141610 141610 0.00
crit 6.7 17.62% 9070.98 8881 9769 9063.33 0 9769 60601 60601 0.00
 
 

Action details: purifying_tick

Static Values
  • id:295338
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295338
  • name:Purifying Blast
  • school:fire
  • tooltip:
  • description:{$@spelldesc295337=Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4043.71
  • base_dd_max:4043.71
  • base_dd_mult:1.00
 
Shooting Stars 791 2.2% 44.0 6.61sec 5377 0 Direct 44.0 4559 9113 5377 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.01 44.01 0.00 0.00 0.0000 0.0000 236659.95 236659.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.11 82.04% 4559.20 4180 5756 4561.04 4284 4999 164623 164623 0.00
crit 7.91 17.96% 9112.53 8360 11513 9110.38 0 11513 72037 72037 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2768 (4381) 7.7% (12.2%) 91.4 3.21sec 14348 15918 Direct 91.9 7642 15277 9013 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.38 91.89 0.00 0.00 0.9014 0.0000 828181.52 828181.52 0.00 15918.03 15918.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.39 82.04% 7641.61 6967 9594 7646.24 7387 8014 576079 576079 0.00
crit 16.50 17.96% 15277.02 13933 19188 15285.83 13933 17333 252102 252102 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1614 4.5% 73.2 3.99sec 6599 0 Direct 73.2 6599 0 6599 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.19 73.19 0.00 0.00 0.0000 0.0000 482971.00 482971.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.19 100.00% 6599.13 5086 14007 6603.17 5769 7862 482971 482971 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 11702 32.5% 60.4 4.99sec 57959 55149 Direct 60.2 49255 98443 58146 18.1%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.41 60.21 0.00 0.00 1.0510 0.0000 3501003.78 3501003.78 0.00 55148.68 55148.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.33 81.92% 49254.65 45067 61614 49277.49 47412 51950 2429588 2429588 0.00
crit 10.88 18.08% 98442.67 90135 123227 98479.33 90135 112089 1071416 1071416 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1585 4.4% 12.7 23.57sec 37242 35844 Direct 12.7 2396 4791 2826 17.9%  
Periodic 218.2 1703 3404 2008 17.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 218.23 218.23 1.0391 1.3468 474290.30 474290.30 0.00 1544.18 35844.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.45 82.06% 2395.96 2231 3073 2397.13 2231 2609 25040 25040 0.00
crit 2.28 17.94% 4791.07 4463 6146 4408.96 0 6146 10944 10944 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.1 82.06% 1703.17 6 2151 1704.00 1659 1777 304989 304989 0.00
crit 39.2 17.94% 3404.26 50 4302 3405.71 3192 3677 133317 133317 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5739 15.9% 88.7 3.13sec 19263 0 Direct 88.7 16350 32702 19263 17.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.66 88.66 0.00 0.00 0.0000 0.0000 1707942.81 1707942.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.87 82.18% 16349.55 15985 17583 16349.26 15985 17289 1191321 1191321 0.00
crit 15.80 17.82% 32701.64 31970 35167 32701.53 31970 35167 516622 516622 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2720 7.6% 17.9 16.63sec 45396 44215 Direct 17.9 3914 7833 4614 17.9%  
Periodic 219.7 2823 5641 3328 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 219.72 219.72 1.0267 1.3451 813907.38 813907.38 0.00 2592.32 44214.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.73 82.14% 3913.54 3570 4917 3914.33 3685 4265 57633 57633 0.00
crit 3.20 17.86% 7833.06 7141 9834 7597.12 0 9834 25087 25087 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.3 82.08% 2822.61 2 3565 2823.96 2750 2940 509057 509057 0.00
crit 39.4 17.92% 5641.36 4 7129 5643.78 5322 6074 222131 222131 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.40sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.12sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.1 44.7sec 5.0sec 92.83% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.32%
  • arcanic_pulsar_2:10.29%
  • arcanic_pulsar_3:11.26%
  • arcanic_pulsar_4:10.63%
  • arcanic_pulsar_5:13.76%
  • arcanic_pulsar_6:10.34%
  • arcanic_pulsar_7:10.89%
  • arcanic_pulsar_8:14.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.12% 7.66% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.76% 32.51% 0.0(0.0) 8.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.6sec 23.62% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.21% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.6 45.2 9.0sec 3.8sec 81.82% 99.69% 1.8(1.8) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.32%
  • lunar_empowerment_2:31.49%
  • lunar_empowerment_3:14.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.5 64.6sec 34.0sec 47.59% 0.00% 3.5(48.2) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.40%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.4 51.1 12.1sec 4.0sec 85.64% 79.77% 0.3(0.3) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.19%
  • solar_empowerment_2:39.55%
  • solar_empowerment_3:17.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.2 20.3sec 5.0sec 97.03% 92.05% 15.4(15.4) 11.4

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.91%
  • starlord_2:22.44%
  • starlord_3:59.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.7sec 23.67% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.67%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 60.4 2416.2 40.0 40.0 1449.0
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.38 738.99 (31.07%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.93 53.79 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.01 176.04 (7.40%) 4.00 0.01 0.00%
moonfire Astral Power 14.06 42.18 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.88 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 75.94 911.25 (38.31%) 12.00 0.05 0.01%
natures_balance Astral Power 400.03 200.01 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.19 74.29 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.59 0.00 90.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data purification protocol Damage Per Second
Count 7592
Mean 36024.23
Minimum 32944.11
Maximum 40237.77
Spread ( max - min ) 7293.66
Range [ ( max - min ) / 2 * 100% ] 10.12%
Standard Deviation 1123.0588
5th Percentile 34272.76
95th Percentile 37958.45
( 95th Percentile - 5th Percentile ) 3685.69
Mean Distribution
Standard Deviation 12.8892
95.00% Confidence Intervall ( 35998.97 - 36049.50 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3734
0.1 Scale Factor Error with Delta=300 10767
0.05 Scale Factor Error with Delta=300 43068
0.01 Scale Factor Error with Delta=300 1076685
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 7592
Mean 36024.23
Minimum 32944.11
Maximum 40237.77
Spread ( max - min ) 7293.66
Range [ ( max - min ) / 2 * 100% ] 10.12%
Standard Deviation 1123.0588
5th Percentile 34272.76
95th Percentile 37958.45
( 95th Percentile - 5th Percentile ) 3685.69
Mean Distribution
Standard Deviation 12.8892
95.00% Confidence Intervall ( 35998.97 - 36049.50 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3734
0.1 Scale Factor Error with Delta=300 10767
0.05 Scale Factor Error with Delta=300 43068
0.01 Scale Factor Error with Delta=300 1076685
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 7592
Mean 36024.23
Minimum 32944.11
Maximum 40237.77
Spread ( max - min ) 7293.66
Range [ ( max - min ) / 2 * 100% ] 10.12%
Damage
Sample Data purification protocol Damage
Count 7592
Mean 10770232.04
Minimum 8474699.75
Maximum 13231666.52
Spread ( max - min ) 4756966.78
Range [ ( max - min ) / 2 * 100% ] 22.08%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
H 5.46 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.78 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.41 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.06 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.76 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.51 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.30 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.30 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.64 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQKRQKRQRNRQORQRKPKRLKQQRQRRRRKRKRKRQRMQKNQQPKQRQKQRRRRHNKOQRKQPRQKQRRRNRRRKRKRQKMQQKPRNQRRRRRKKOQQKRQRNKQPRHRRRKGQKORQRKLQRRKQRRRPRQKKRQONQKRQQKRQRRQKPKNQORQKRQRKHLRQIEFKRQKPRQKORQKRQNRQRQMRKKQQKRPQRNQRKRQRJKRMQKQQKRNQKPRHQQRGKQKORQKNRQQKRQRPQRRKKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H purifying_blast Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.248 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, battle_potion_of_intellect
0:02.209 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:03.142 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.073 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:05.006 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:05.820 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:05.820 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:05.820 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.574 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.327 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.203 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.958 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.711 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.562 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.316 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.070 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.891 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.645 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.399 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.188 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.942 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.698 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.453 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.240 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.994 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.749 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.586 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.340 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.095 default P stellar_flare Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.850 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.605 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:24.358 default L sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:25.113 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:25.866 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
0:26.989 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
0:28.113 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
0:28.868 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:29.991 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3), torrent_of_elements
0:30.745 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
0:31.501 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
0:32.257 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements
0:33.140 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:34.023 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:34.779 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3)
0:35.548 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:36.303 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:37.070 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
0:37.824 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3)
0:38.804 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3)
0:39.572 default M moonfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3)
0:40.340 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
0:41.464 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment
0:42.712 default N sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord
0:43.925 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord
0:45.471 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
0:47.016 default P stellar_flare Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements
0:48.229 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements
0:49.441 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
0:50.943 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements
0:51.944 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
0:53.444 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements
0:54.620 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:56.081 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
0:57.055 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
0:58.028 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
0:59.173 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
1:00.318 default H purifying_blast Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
1:01.461 default N sunfire Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements
1:02.607 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), torrent_of_elements
1:03.856 default O moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:05.067 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:06.612 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), solar_empowerment, starlord, torrent_of_elements
1:07.643 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), starlord, torrent_of_elements
1:08.857 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:10.359 default P stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25)
1:11.435 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(24)
1:12.357 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(2), overwhelming_power(23)
1:13.738 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(22)
1:14.825 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
1:16.179 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:17.089 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(18)
1:18.001 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(17)
1:19.078 default N sunfire Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16)
1:20.159 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15)
1:21.243 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14)
1:22.331 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13)
1:23.425 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), overwhelming_power(12)
1:24.620 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11)
1:25.480 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(10)
1:26.495 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(9)
1:27.338 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(8)
1:28.607 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(7)
1:29.607 default M moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6)
1:30.580 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(5)
1:32.014 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3)
1:33.458 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(2)
1:34.596 default P stellar_flare Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power
1:35.736 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3)
1:36.709 default N sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:37.854 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:39.314 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:40.288 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3)
1:41.261 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(24)
1:42.312 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(23)
1:43.367 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(22)
1:44.425 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(3), overwhelming_power(21)
1:45.581 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20)
1:46.708 default O moonfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19)
1:47.809 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18)
1:49.214 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
1:50.629 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(15)
1:51.743 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
1:52.669 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
1:54.061 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(11)
1:54.997 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(11)
1:56.097 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(9)
1:57.206 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
1:58.624 default P stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(7)
1:59.738 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(6)
2:00.691 default H purifying_blast Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(5)
2:01.816 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(4)
2:02.777 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(3)
2:03.909 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(2), conch_of_dark_whispers
2:05.046 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), conch_of_dark_whispers
2:06.292 default G use_items Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:06.292 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse
2:07.774 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse
2:08.938 default O moonfire Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:09.921 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:10.757 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.960 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power celestial_alignment, solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.763 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, starlord(2), overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.632 default L sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.481 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.684 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.488 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, starlord(3), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.439 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, starlord(3), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.393 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
2:19.570 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
2:20.357 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(17), ignition_mages_fuse(4)
2:21.287 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(16), ignition_mages_fuse(4)
2:22.219 default P stellar_flare Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(15), ignition_mages_fuse(4)
2:23.153 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(5)
2:24.060 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(13), ignition_mages_fuse(5)
2:25.219 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(2), solar_empowerment, overwhelming_power(12), ignition_mages_fuse(5)
2:26.213 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(11), ignition_mages_fuse(5)
2:27.182 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(10)
2:28.148 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(9)
2:29.599 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8)
2:30.741 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7)
2:31.889 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6)
2:33.356 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4)
2:34.517 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3)
2:35.478 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2)
2:36.926 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power
2:38.380 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3)
2:39.526 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
2:40.501 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:41.960 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:42.933 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:43.907 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3)
2:45.368 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(6), conch_of_dark_whispers
2:46.617 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:47.831 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:49.045 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:50.222 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:51.723 default O moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
2:52.900 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
2:53.903 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:55.404 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:56.583 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:57.430 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:58.698 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:59.546 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
3:00.542 default H purifying_blast Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:01.689 default L sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:02.685 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:03.658 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:05.116 default I celestial_alignment Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
3:06.113 default E potion Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2)
3:06.113 default F berserking Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), battle_potion_of_intellect
3:06.113 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), battle_potion_of_intellect
3:07.099 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, battle_potion_of_intellect
3:07.914 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, battle_potion_of_intellect
3:09.135 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:10.094 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:11.028 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:11.820 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:13.005 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:13.936 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:14.843 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:15.614 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:16.767 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:17.675 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:18.446 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:19.716 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:20.713 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:21.560 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:22.830 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:23.676 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect
3:24.944 default M moonfire Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), battle_potion_of_intellect
3:25.940 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(5), starlord(3), battle_potion_of_intellect
3:27.084 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(5), battle_potion_of_intellect
3:28.333 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
3:29.546 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:31.046 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect
3:32.546 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements
3:33.723 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:34.696 default P stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:35.842 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:37.302 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
3:38.277 default N sunfire Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
3:39.325 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
3:40.663 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
3:41.559 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
3:42.616 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
3:43.401 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
3:44.582 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)
3:45.513 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
3:45.513 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(18)
3:46.531 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17)
3:47.372 default M moonfire Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(16)
3:48.368 default Q lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, lunar_empowerment(3), starlord, overwhelming_power(15)
3:49.829 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(14)
3:50.980 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25)
3:52.351 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
3:53.733 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers
3:54.820 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers
3:55.722 default N sunfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
3:56.789 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
3:58.151 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
3:59.227 default P stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
4:00.309 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
4:01.231 default H purifying_blast Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
4:02.318 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
4:03.710 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
4:05.107 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
4:06.046 default G use_items Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(4), solar_empowerment, torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
4:06.046 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(4), solar_empowerment, torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse
4:07.204 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse
4:08.645 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse
4:09.779 default O moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers, ignition_mages_fuse
4:10.884 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(5), conch_of_dark_whispers, ignition_mages_fuse(2)
4:11.791 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.155 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), ignition_mages_fuse(2)
4:14.233 default N sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.245 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.108 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.403 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.698 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.677 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.508 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.756 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.588 default P stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.533 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.738 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.541 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.487 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(8), conch_of_dark_whispers
4:27.735 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
4:28.789 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

ripple in space : 36235 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36234.5 36234.5 25.7 / 0.071% 4396.6 / 12.1% 4483.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 36235
Heed My Call 292 (417) 0.8% (1.2%) 8.1 33.41sec 15382 0 Direct 8.1 9106 18226 10762 18.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.12 8.12 0.00 0.00 0.0000 0.0000 87403.40 87403.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.65 81.84% 9105.65 8901 9791 9105.12 8901 9791 60518 60518 0.00
crit 1.48 18.16% 18225.94 17802 19582 14252.91 0 19582 26886 26886 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.3% 8.1 33.41sec 4620 0 Direct 8.1 3903 7803 4619 18.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.12 8.12 0.00 0.00 0.0000 0.0000 37517.03 37517.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.63 81.63% 3903.29 3815 4196 3902.81 3815 4196 25878 25878 0.00
crit 1.49 18.37% 7803.34 7629 8392 6131.56 0 8392 11639 11639 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5179 14.3% 76.0 3.84sec 20389 15577 Direct 76.0 17279 34518 20389 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.03 76.03 0.00 0.00 1.3090 0.0000 1550105.34 1550105.34 0.00 15576.60 15576.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.31 81.96% 17278.75 8882 22539 17286.14 16566 18260 1076615 1076615 0.00
crit 13.72 18.04% 34518.38 17765 45078 34535.20 30434 39847 473490 473490 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2545 7.0% 14.1 21.31sec 54143 53002 Direct 14.1 2982 5961 3513 17.8%  
Periodic 220.6 2738 5469 3227 17.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 220.61 220.61 1.0215 1.3439 761432.73 761432.73 0.00 2449.61 53002.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 82.16% 2981.71 2589 3780 2983.87 2739 3295 34451 34451 0.00
crit 2.51 17.84% 5960.51 5177 7561 5588.32 0 7561 14957 14957 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 82.07% 2737.78 1 3520 2739.08 2655 2866 495699 495699 0.00
crit 39.6 17.93% 5469.36 10 7039 5471.85 5073 5978 216326 216326 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Ripple in Space 348 1.0% 5.5 60.37sec 19011 16572 Direct 5.4 19122 0 19122 0.0%  

Stats details: ripple_in_space

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 5.43 0.00 0.00 1.1473 0.0000 103872.60 103872.60 0.00 16571.89 16571.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.43 100.00% 19121.76 18744 20618 19120.87 18744 20306 103873 103873 0.00
 
 

Action details: ripple_in_space

Static Values
  • id:302731
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:302731
  • name:Ripple in Space
  • school:physical
  • tooltip:About to relocate with Ripple in Space.
  • description:Create an Azerite beacon at a target location. After {$d=4 seconds}, the Heart of Azeroth will relocate you to this beacon and deal {$s2=4952} Fire damage to all nearby enemies.$?a302780[ For {$302864d=10 seconds} after being relocated, you take {$302864s1=10}% reduced damage.][]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17069.54
  • base_dd_max:17069.54
  • base_dd_mult:1.00
 
Shooting Stars 825 2.3% 44.0 6.61sec 5604 0 Direct 44.0 4751 9505 5604 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.04 44.04 0.00 0.00 0.0000 0.0000 246823.65 246823.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.14 82.05% 4751.09 4180 6104 4753.33 4392 5199 171699 171699 0.00
crit 7.90 17.95% 9505.35 8360 12209 9510.88 0 12209 75125 75125 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2880 (4561) 8.0% (12.6%) 91.3 3.22sec 14950 16591 Direct 91.8 7963 15916 9386 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.30 91.82 0.00 0.00 0.9011 0.0000 861835.41 861835.41 0.00 16591.05 16591.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.38 82.10% 7963.00 6967 10174 7968.28 7669 8466 600284 600284 0.00
crit 16.43 17.90% 15915.84 13933 20348 15923.00 14439 18266 261551 261551 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1681 4.6% 73.2 3.98sec 6870 0 Direct 73.2 6870 0 6870 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.24 73.24 0.00 0.00 0.0000 0.0000 503143.59 503143.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.24 100.00% 6869.61 5086 14854 6873.60 5973 8262 503144 503144 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10171.21
  • base_dd_max:10171.21
  • base_dd_mult:1.00
 
Starsurge 12124 33.5% 60.4 4.99sec 60040 57134 Direct 60.2 51106 102045 60231 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.41 60.22 0.00 0.00 1.0509 0.0000 3627141.68 3627141.68 0.00 57133.84 57133.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.43 82.08% 51105.89 45067 65034 51130.64 49251 53790 2526195 2526195 0.00
crit 10.79 17.92% 102044.84 90135 130068 102082.46 90135 126127 1100946 1100946 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1651 4.6% 12.7 23.57sec 38803 37361 Direct 12.7 2492 4984 2936 17.8%  
Periodic 218.3 1774 3545 2093 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.73 12.73 218.25 218.25 1.0386 1.3466 494096.70 494096.70 0.00 1608.82 37360.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.46 82.17% 2491.65 2231 3259 2492.68 2305 2737 26071 26071 0.00
crit 2.27 17.83% 4984.33 4463 6518 4539.52 0 6518 11316 11316 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.0 82.01% 1773.92 7 2281 1774.78 1724 1861 317507 317507 0.00
crit 39.3 17.99% 3545.21 49 4562 3546.67 3326 3854 139203 139203 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5751 15.8% 88.7 3.13sec 19291 0 Direct 88.7 16354 32716 19291 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.72 88.72 0.00 0.00 0.0000 0.0000 1711426.55 1711426.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.79 82.05% 16354.49 15985 17583 16354.49 15985 17342 1190517 1190517 0.00
crit 15.92 17.95% 32715.74 31970 35167 32714.94 31970 35167 520910 520910 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2835 7.8% 17.9 16.60sec 47320 46090 Direct 17.9 4081 8156 4817 18.1%  
Periodic 219.8 2940 5874 3468 18.0% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 219.76 219.76 1.0267 1.3449 848463.96 848463.96 0.00 2702.46 46089.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.69 81.94% 4080.97 3570 5214 4082.20 3811 4468 59960 59960 0.00
crit 3.24 18.06% 8155.87 7141 10429 7902.85 0 10429 26407 26407 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.2 82.01% 2940.05 2 3780 2941.47 2851 3096 529867 529867 0.00
crit 39.5 17.99% 5874.32 33 7561 5877.30 5467 6467 232230 232230 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.43sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.16sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9043 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.1 44.7sec 5.0sec 92.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.33%
  • arcanic_pulsar_2:10.27%
  • arcanic_pulsar_3:11.29%
  • arcanic_pulsar_4:10.61%
  • arcanic_pulsar_5:13.76%
  • arcanic_pulsar_6:10.39%
  • arcanic_pulsar_7:10.84%
  • arcanic_pulsar_8:14.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.12% 7.86% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.77% 32.52% 0.0(0.0) 8.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.4sec 23.75% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.21% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.5 45.4 9.0sec 3.8sec 81.97% 99.70% 1.8(1.8) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.23%
  • lunar_empowerment_2:31.63%
  • lunar_empowerment_3:14.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.5 64.5sec 33.8sec 47.86% 0.00% 3.5(48.4) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reality Shift 9.7 0.0 32.2sec 32.2sec 62.99% 0.00% 188.4(188.4) 9.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_reality_shift
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:668.07

Stack Uptimes

  • reality_shift_1:62.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302916
  • name:Reality Shift
  • tooltip:
  • description:$?a302961[Your movement speed is increased by {$302961s1=5}%, and when][When] you move more than {$s1=25} yds within {$s4=4} sec, gain {$s2=194} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] for {$302952d=15 seconds}. This can only occur once every {$302953d=30 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.2 51.4 12.2sec 4.0sec 85.77% 79.90% 0.3(0.3) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.04%
  • solar_empowerment_2:39.68%
  • solar_empowerment_3:18.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.03% 92.05% 15.4(15.4) 11.4

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.89%
  • starlord_2:22.46%
  • starlord_3:59.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.7sec 23.68% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.68%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 60.4 2416.5 40.0 40.0 1501.0
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.30 738.38 (31.04%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.93 53.79 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.04 176.15 (7.40%) 4.00 0.01 0.00%
moonfire Astral Power 14.06 42.19 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.73 101.87 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.03 912.25 (38.35%) 12.00 0.06 0.01%
natures_balance Astral Power 400.03 200.01 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.19 74.34 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.29 0.00 76.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data ripple in space Damage Per Second
Count 7592
Mean 36234.51
Minimum 31741.53
Maximum 40843.40
Spread ( max - min ) 9101.87
Range [ ( max - min ) / 2 * 100% ] 12.56%
Standard Deviation 1141.9829
5th Percentile 34463.43
95th Percentile 38191.37
( 95th Percentile - 5th Percentile ) 3727.94
Mean Distribution
Standard Deviation 13.1063
95.00% Confidence Intervall ( 36208.82 - 36260.20 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3816
0.1 Scale Factor Error with Delta=300 11133
0.05 Scale Factor Error with Delta=300 44532
0.01 Scale Factor Error with Delta=300 1113277
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 7592
Mean 36234.51
Minimum 31741.53
Maximum 40843.40
Spread ( max - min ) 9101.87
Range [ ( max - min ) / 2 * 100% ] 12.56%
Standard Deviation 1141.9829
5th Percentile 34463.43
95th Percentile 38191.37
( 95th Percentile - 5th Percentile ) 3727.94
Mean Distribution
Standard Deviation 13.1063
95.00% Confidence Intervall ( 36208.82 - 36260.20 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3816
0.1 Scale Factor Error with Delta=300 11133
0.05 Scale Factor Error with Delta=300 44532
0.01 Scale Factor Error with Delta=300 1113277
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 7592
Mean 36234.51
Minimum 31741.53
Maximum 40843.40
Spread ( max - min ) 9101.87
Range [ ( max - min ) / 2 * 100% ] 12.56%
Damage
Sample Data ripple in space Damage
Count 7592
Mean 10833262.64
Minimum 8365214.98
Maximum 13433863.28
Spread ( max - min ) 5068648.30
Range [ ( max - min ) / 2 * 100% ] 23.39%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
H 5.46 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.80 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.41 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.06 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.50 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.28 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.73 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.38 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.56 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.37 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRQKRQNRORQJKRQKPRLQKQQRQRRKRKRQRQRMKKQNQKPRQQKRQRRRRQHKKNOQRKPRQQRQRKNRQKRMQQKRQKPRQNRQJKRQKROQKRQKRQNRPQHRKRGKRQKRQMRKNRQKRQQPQRKRQRKNORQKRQKRQQRKPQNKRQRKRMQQKQHRRQIEFKNKPRQKORQRKRQRKRQRQLQKQKRQKPRMQKRQQNRRRRKQKQRRKQOPNHKQGRQRKQRRRKQQKNRQKPRMQRKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H ripple_in_space Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, reality_shift, battle_potion_of_intellect
0:02.210 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.144 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.077 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.010 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), battle_potion_of_intellect
0:05.764 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), battle_potion_of_intellect
0:05.764 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), battle_potion_of_intellect
0:05.764 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse
0:06.518 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:07.271 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
0:08.026 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse
0:08.780 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse
0:09.570 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse
0:10.326 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.081 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.837 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.607 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.362 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.138 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.895 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.650 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(15), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.404 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.159 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.915 default O moonfire Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.671 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(12), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.426 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.235 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.235 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.990 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.744 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(9), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.603 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(8), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.358 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(7), ignition_mages_fuse(5)
0:24.112 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(6), ignition_mages_fuse(5)
0:24.867 default L sunfire Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(6), ignition_mages_fuse(5)
0:25.621 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), starlord(2), overwhelming_power(5), ignition_mages_fuse(5)
0:26.561 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), starlord(2), overwhelming_power(4)
0:27.455 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3)
0:28.566 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2)
0:29.682 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power
0:30.437 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:31.559 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:32.313 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:33.067 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, reality_shift, arcanic_pulsar(8), starlord(3)
0:33.951 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:34.706 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, reality_shift, celestial_alignment, lunar_empowerment, starlord(3)
0:35.473 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:36.227 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:37.203 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:37.971 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:38.948 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, starlord(3)
0:39.714 default M moonfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, starlord(3)
0:40.481 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, reality_shift, arcanic_pulsar
0:41.442 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
0:42.655 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:44.154 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:45.332 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25)
0:46.703 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(24)
0:47.783 default P stellar_flare Fluffy_Pillow 6.5/100: 7% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23)
0:48.836 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22)
0:49.735 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21)
0:51.087 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
0:52.448 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(18)
0:53.521 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17)
0:54.434 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
0:55.812 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(15)
0:56.734 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(14)
0:57.658 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(13)
0:58.586 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(12)
0:59.683 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(11)
1:01.086 default H ripple_in_space Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(5), overwhelming_power(9)
1:02.294 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(5), overwhelming_power(8)
1:03.506 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7)
1:04.686 default N sunfire Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6)
1:05.838 default O moonfire Fluffy_Pillow 17.5/100: 18% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(5)
1:06.994 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4)
1:08.472 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(2)
1:09.465 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power
1:10.640 default P stellar_flare Fluffy_Pillow 8.0/100: 8% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:11.785 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:12.757 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:14.217 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:15.677 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(3), starlord(3)
1:16.649 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:18.109 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:19.082 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3)
1:20.229 default N sunfire Fluffy_Pillow 66.0/100: 66% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
1:21.226 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
1:22.073 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
1:23.343 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power celestial_alignment, lunar_empowerment, solar_empowerment
1:24.430 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord
1:25.327 default M moonfire Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord
1:26.383 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord
1:27.928 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(24)
1:29.342 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(22)
1:30.460 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(21)
1:31.387 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20)
1:32.783 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19)
1:33.882 default P stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18)
1:34.954 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17)
1:35.869 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
1:37.245 default N sunfire Fluffy_Pillow 67.5/100: 68% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
1:38.333 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13)
1:39.260 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
1:40.655 default J cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11)
1:40.655 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), torrent_of_elements, overwhelming_power(11)
1:41.854 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(10)
1:42.847 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(9)
1:44.341 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(7)
1:45.522 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(6)
1:46.500 default O moonfire Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5)
1:47.657 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(4)
1:49.137 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(2)
1:50.308 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power
1:51.277 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:52.737 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:53.882 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
1:54.855 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:56.313 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
1:57.459 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
1:58.431 default P stellar_flare Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:59.576 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
2:01.036 default H ripple_in_space Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(7), solar_empowerment(3)
2:02.334 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), solar_empowerment(3)
2:03.396 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(7), solar_empowerment(2)
2:04.646 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements
2:05.677 default G use_items Fluffy_Pillow 55.5/100: 56% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
2:05.677 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse
2:06.842 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse
2:07.680 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse
2:08.931 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse
2:09.914 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:10.696 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.867 default M moonfire Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.788 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.686 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.703 default N sunfire Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.718 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.582 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.879 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.858 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.691 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.939 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.187 default P stellar_flare Fluffy_Pillow 44.5/100: 45% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.132 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.337 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(3), ignition_mages_fuse(5)
2:25.212 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(3), solar_empowerment(2), ignition_mages_fuse(5)
2:26.242 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord
2:27.272 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord
2:28.816 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord
2:29.846 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord
2:31.059 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:32.237 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:33.413 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:34.416 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:35.916 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
2:37.093 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:38.068 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:39.528 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:40.674 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:41.649 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:43.109 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
2:44.570 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(25)
2:45.461 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, overwhelming_power(24)
2:46.606 default P stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23)
2:47.722 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(22)
2:49.148 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord, overwhelming_power(20)
2:50.275 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord, overwhelming_power(19)
2:51.405 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(18)
2:52.221 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17)
2:53.447 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power reality_shift, celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(16)
2:54.270 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(15)
2:55.242 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
2:56.045 default M moonfire Fluffy_Pillow 12.0/100: 12% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13)
2:56.994 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13)
2:58.386 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
2:59.724 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(23)
3:00.778 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
3:02.125 default H ripple_in_space Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:03.191 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
3:04.101 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers
3:05.012 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
3:06.382 default I celestial_alignment Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), celestial_alignment, overwhelming_power(16), conch_of_dark_whispers
3:07.406 default E potion Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(2), celestial_alignment, overwhelming_power(15), conch_of_dark_whispers
3:07.406 default F berserking Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(2), celestial_alignment, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:07.406 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power berserking, arcanic_pulsar(2), celestial_alignment, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:08.339 default N sunfire Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:09.250 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
3:10.166 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
3:11.058 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
3:11.817 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
3:12.957 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect
3:13.856 default O moonfire Fluffy_Pillow 6.0/100: 6% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:14.684 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:15.439 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:16.501 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:17.257 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect
3:18.098 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), battle_potion_of_intellect
3:18.852 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:19.925 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:20.855 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:21.787 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:22.584 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:23.782 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:24.726 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:25.931 default L sunfire Fluffy_Pillow 49.0/100: 49% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
3:26.881 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
3:28.278 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect
3:29.481 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(9), conch_of_dark_whispers, battle_potion_of_intellect
3:30.975 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord, overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
3:32.151 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
3:33.003 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers
3:34.285 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4)
3:35.296 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3)
3:36.280 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24)
3:37.056 default M moonfire Fluffy_Pillow 27.5/100: 28% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
3:37.973 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
3:39.315 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
3:40.377 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
3:41.284 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
3:42.644 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
3:44.010 default N sunfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
3:45.088 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(15)
3:46.010 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(14)
3:46.935 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(14)
3:48.023 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(12)
3:49.120 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(2), overwhelming_power(11)
3:50.319 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(10)
3:51.809 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(9)
3:52.982 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8)
3:54.440 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(6)
3:55.419 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(5)
3:56.404 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4)
3:57.564 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3)
3:59.009 default O moonfire Fluffy_Pillow 20.0/100: 20% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power
4:00.150 default P stellar_flare Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
4:01.296 default N sunfire Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
4:02.441 default H ripple_in_space Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
4:03.588 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
4:04.734 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
4:06.195 default G use_items Fluffy_Pillow 15.0/100: 15% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
4:06.195 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
4:07.128 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
4:08.529 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
4:09.463 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, torrent_of_elements, ignition_mages_fuse
4:10.662 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(2)
4:12.085 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(2)
4:13.036 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(2)
4:13.987 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), starlord, torrent_of_elements, ignition_mages_fuse(2)
4:15.104 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(3)
4:16.179 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(3)
4:17.510 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(3)
4:18.840 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(4)
4:19.848 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
4:20.700 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
4:21.454 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:22.541 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, celestial_alignment, solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:23.364 default P stellar_flare Fluffy_Pillow 5.5/100: 6% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
4:24.185 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
4:24.937 default M moonfire Fluffy_Pillow 26.5/100: 27% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:25.761 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:26.964 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar, solar_empowerment(2), starlord(3)
4:27.936 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
4:29.080 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

unbound force : 36684 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36684.1 36684.1 25.3 / 0.069% 4379.3 / 11.9% 4529.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 36684
Heed My Call 303 (432) 0.8% (1.2%) 8.2 33.38sec 15880 0 Direct 8.2 9107 18222 11118 22.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.15 8.15 0.00 0.00 0.0000 0.0000 90656.09 90656.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.35 77.93% 9106.92 8901 9791 9105.47 0 9791 57869 57869 0.00
crit 1.80 22.07% 18221.58 17802 19582 15325.92 0 19582 32787 32787 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.4% 8.2 33.38sec 4761 0 Direct 8.2 3903 7807 4761 22.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.15 8.15 0.00 0.00 0.0000 0.0000 38822.21 38822.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.36 78.02% 3903.22 3815 4196 3900.61 0 4196 24831 24831 0.00
crit 1.79 21.98% 7807.44 7629 8392 6587.20 0 8392 13991 13991 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5071 13.8% 76.1 3.84sec 19950 15226 Direct 76.1 16589 33101 19950 20.4%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.09 76.09 0.00 0.00 1.3102 0.0000 1518029.39 1518029.39 0.00 15226.43 15226.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.61 79.65% 16589.31 8882 21253 16596.68 15963 17473 1005402 1005402 0.00
crit 15.49 20.35% 33100.78 17765 42507 33113.70 28779 38481 512627 512627 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2518 6.9% 14.1 21.33sec 53593 52453 Direct 14.1 2856 5691 3472 21.7%  
Periodic 220.6 2631 5239 3193 21.6% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 220.64 220.64 1.0218 1.3437 753437.50 753437.50 0.00 2423.89 52453.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.00 78.26% 2855.92 2589 3565 2857.73 2621 3149 31423 31423 0.00
crit 3.06 21.74% 5691.24 5177 7129 5510.48 0 7129 17392 17392 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.0 78.42% 2630.55 2 3319 2631.79 2552 2769 455181 455181 0.00
crit 47.6 21.58% 5239.48 32 6638 5241.45 4961 5721 249443 249443 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 819 2.2% 44.1 6.61sec 5558 0 Direct 44.1 4564 9090 5558 22.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.11 44.11 0.00 0.00 0.0000 0.0000 245155.87 245155.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.42 78.03% 4564.18 4180 5756 4565.94 4238 4966 157082 157082 0.00
crit 9.69 21.97% 9089.51 8360 11513 9091.85 8360 11513 88074 88074 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2833 (4483) 7.7% (12.2%) 91.7 3.20sec 14622 16202 Direct 92.3 7640 15251 9189 20.3%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.75 92.27 0.00 0.00 0.9025 0.0000 847871.79 847871.79 0.00 16201.54 16201.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.50 79.65% 7640.14 6967 9594 7644.65 7349 8143 561513 561513 0.00
crit 18.78 20.35% 15251.46 13933 19188 15259.67 13933 16928 286359 286359 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1649 4.5% 73.3 3.99sec 6732 0 Direct 73.3 6732 0 6732 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.33 73.33 0.00 0.00 0.0000 0.0000 493648.01 493648.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.33 100.00% 6731.74 5086 14007 6735.27 5769 8006 493648 493648 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10171.21
  • base_dd_max:10171.21
  • base_dd_mult:1.00
 
Starsurge 11999 32.7% 60.5 4.98sec 59300 56400 Direct 60.3 49280 98161 59492 20.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.54 60.34 0.00 0.00 1.0514 0.0000 3589776.19 3589776.19 0.00 56400.46 56400.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.73 79.11% 49280.25 45067 61614 49303.92 47264 52106 2352383 2352383 0.00
crit 12.61 20.89% 98160.88 90135 123227 98194.02 90135 114330 1237393 1237393 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1631 4.5% 12.7 23.58sec 38336 36940 Direct 12.7 2400 4792 2899 20.8%  
Periodic 218.3 1705 3397 2068 21.5% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 218.30 218.30 1.0378 1.3464 488275.94 488275.94 0.00 1589.82 36940.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.08 79.15% 2399.72 2231 3073 2400.83 2231 2656 24193 24193 0.00
crit 2.66 20.85% 4791.93 4463 6146 4545.76 0 6146 12723 12723 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.5 78.55% 1704.68 4 2151 1705.49 1652 1789 292294 292294 0.00
crit 46.8 21.45% 3396.69 16 4302 3398.19 3169 3648 159066 159066 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5815 15.8% 88.2 3.15sec 19621 0 Direct 88.2 16353 32709 19621 20.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.20 88.20 0.00 0.00 0.0000 0.0000 1730594.29 1730594.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.58 80.02% 16352.92 15985 17583 16352.48 15985 17195 1154125 1154125 0.00
crit 17.62 19.98% 32709.46 31970 35167 32711.20 31970 34710 576469 576469 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2802 7.6% 18.0 16.58sec 46688 45534 Direct 18.0 3919 7804 4755 21.5%  
Periodic 219.8 2825 5627 3427 21.5% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.96 17.96 219.80 219.80 1.0254 1.3447 838600.92 838600.92 0.00 2670.86 45534.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.09 78.47% 3918.62 3570 4917 3919.52 3660 4332 55230 55230 0.00
crit 3.87 21.53% 7804.43 7141 9834 7696.87 0 9834 30184 30184 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.6 78.54% 2825.27 7 3565 2826.58 2748 2964 487714 487714 0.00
crit 47.2 21.46% 5626.98 23 7129 5629.54 5310 6005 265474 265474 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
The Unbound Force 1114 3.0% 5.0 67.22sec 67240 60450 Periodic 60.7 1322 6799 5506 76.4% 3.3%

Stats details: the_unbound_force

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.97 0.00 39.60 60.66 1.1124 0.2500 333984.65 333984.65 0.00 21652.17 60449.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.3 23.60% 1322.01 87 1575 1320.38 1018 1537 18927 18927 0.00
crit 46.3 76.40% 6798.98 434 7875 6799.02 6263 7629 315058 315058 0.00
 
 

Action details: the_unbound_force

Static Values
  • id:298452
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.reckless_force.up|time<5
Spelldata
  • id:298452
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: the_unbound_force_tick

Static Values
  • id:298453
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:50.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:298453
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:{$@spelldesc298452=Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1303.78
  • base_dd_max:1303.78
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.37sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.09sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9011 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.2 44.6sec 5.0sec 92.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.27%
  • arcanic_pulsar_2:10.44%
  • arcanic_pulsar_3:11.41%
  • arcanic_pulsar_4:10.54%
  • arcanic_pulsar_5:13.67%
  • arcanic_pulsar_6:10.25%
  • arcanic_pulsar_7:10.82%
  • arcanic_pulsar_8:14.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.12% 7.74% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.80% 32.44% 0.0(0.0) 8.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 60.9sec 45.7sec 23.67% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.22% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.3 45.7 9.1sec 3.8sec 82.20% 99.70% 1.9(1.9) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.75%
  • lunar_empowerment_2:31.92%
  • lunar_empowerment_3:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.6sec 34.1sec 47.55% 0.00% 3.4(47.4) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.40%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 4.0 0.0 66.7sec 66.7sec 5.30% 0.00% 0.0(0.0) 3.9

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.9 84.4 66.6sec 3.3sec 91.56% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.60%
  • reckless_force_counter_2:5.23%
  • reckless_force_counter_3:5.16%
  • reckless_force_counter_4:5.12%
  • reckless_force_counter_5:5.10%
  • reckless_force_counter_6:5.03%
  • reckless_force_counter_7:4.91%
  • reckless_force_counter_8:4.89%
  • reckless_force_counter_9:4.89%
  • reckless_force_counter_10:4.83%
  • reckless_force_counter_11:4.75%
  • reckless_force_counter_12:4.71%
  • reckless_force_counter_13:4.63%
  • reckless_force_counter_14:4.59%
  • reckless_force_counter_15:4.54%
  • reckless_force_counter_16:4.47%
  • reckless_force_counter_17:4.42%
  • reckless_force_counter_18:4.38%
  • reckless_force_counter_19:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 24.4 51.4 12.1sec 4.0sec 85.77% 79.59% 0.3(0.3) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.93%
  • solar_empowerment_2:40.04%
  • solar_empowerment_3:17.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.29% 92.20% 15.4(15.4) 11.4

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.50%
  • starlord_2:22.85%
  • starlord_3:59.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.4sec 23.74% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.74%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 60.5 2421.4 40.0 40.0 1482.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.75 741.93 (31.12%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.96 53.89 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.10 176.41 (7.40%) 4.00 0.01 0.01%
moonfire Astral Power 14.06 42.18 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.89 (4.27%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.09 913.06 (38.30%) 12.00 0.06 0.01%
natures_balance Astral Power 400.03 200.01 (8.39%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.21 74.54 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.96 8.08
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.20 0.00 75.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data unbound force Damage Per Second
Count 7592
Mean 36684.08
Minimum 32897.98
Maximum 41027.44
Spread ( max - min ) 8129.46
Range [ ( max - min ) / 2 * 100% ] 11.08%
Standard Deviation 1122.9726
5th Percentile 34934.94
95th Percentile 38617.11
( 95th Percentile - 5th Percentile ) 3682.17
Mean Distribution
Standard Deviation 12.8882
95.00% Confidence Intervall ( 36658.82 - 36709.34 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3600
0.1 Scale Factor Error with Delta=300 10766
0.05 Scale Factor Error with Delta=300 43061
0.01 Scale Factor Error with Delta=300 1076520
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 7592
Mean 36684.08
Minimum 32897.98
Maximum 41027.44
Spread ( max - min ) 8129.46
Range [ ( max - min ) / 2 * 100% ] 11.08%
Standard Deviation 1122.9726
5th Percentile 34934.94
95th Percentile 38617.11
( 95th Percentile - 5th Percentile ) 3682.17
Mean Distribution
Standard Deviation 12.8882
95.00% Confidence Intervall ( 36658.82 - 36709.34 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3600
0.1 Scale Factor Error with Delta=300 10766
0.05 Scale Factor Error with Delta=300 43061
0.01 Scale Factor Error with Delta=300 1076520
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 7592
Mean 36684.08
Minimum 32897.98
Maximum 41027.44
Spread ( max - min ) 8129.46
Range [ ( max - min ) / 2 * 100% ] 11.08%
Damage
Sample Data unbound force Damage
Count 7592
Mean 10968852.84
Minimum 8573675.78
Maximum 13658744.28
Spread ( max - min ) 5085068.50
Range [ ( max - min ) / 2 * 100% ] 23.18%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
H 4.97 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.86 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.54 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.10 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.73 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.49 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.33 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.44 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.00 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.38 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQKRQKRQRNRQORQRKPKRLQKRQQRQRKRQKRQRQJKKOQNQKPRQQRKRQRRRRKKHNOQQQKPRQRRQRNJKRKRKRMQQKQQPKNQRRQKQROKQRRRKNQRPHRRKQQGKRQKRQMKNRQRQRQPKQKRQRKONQRKQRRRRRRQKKPQNQKORHRKLQQRRQKQRIEFKPKRQKONRQRQRQRJKRKRQKQQRRNPORRKRQJKRKLQQKRQRKQRROPRRQKKNGQQKRQRRKQQRORNRRKRKRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H the_unbound_force Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.250 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, battle_potion_of_intellect
0:02.212 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:03.147 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.080 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:05.014 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.827 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.827 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:05.827 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:06.583 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.338 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.213 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.968 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.721 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:10.572 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.327 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.081 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.903 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(4), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.659 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.413 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.205 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.959 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.713 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.467 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.256 default O moonfire Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.011 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(5), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.763 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), reckless_force_counter(6), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.601 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), reckless_force_counter(6), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.356 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, reckless_force_counter(6), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.111 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(7), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.865 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(7), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.620 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(8), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.374 default L sunfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(8), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.127 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(8), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.080 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(8), conch_of_dark_whispers
0:26.987 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(8), conch_of_dark_whispers
0:27.741 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(8), conch_of_dark_whispers
0:28.863 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(8), conch_of_dark_whispers
0:29.987 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3), reckless_force_counter(8)
0:30.742 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(8)
0:31.866 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(10)
0:32.620 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(10)
0:33.501 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(10)
0:34.256 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(11)
0:35.232 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(13)
0:35.999 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(13)
0:36.755 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(25), reckless_force_counter(13)
0:37.648 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(13)
0:38.401 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(13)
0:39.301 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(13)
0:39.301 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, overwhelming_power(22), reckless_force_counter(13)
0:40.188 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(21), reckless_force_counter(13)
0:41.054 default O moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(20), reckless_force_counter(13)
0:42.151 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(19), reckless_force_counter(14)
0:43.551 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), reckless_force_counter(14)
0:44.654 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), reckless_force_counter(16)
0:46.064 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter(16)
0:47.178 default P stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), reckless_force_counter(16)
0:48.266 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), reckless_force_counter(16)
0:49.195 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12), reckless_force_counter(17)
0:50.592 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(17)
0:51.995 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(10), reckless_force_counter(17)
0:52.935 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(9), reckless_force_counter(17)
0:54.043 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7), reckless_force_counter(17)
0:54.993 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(17)
0:56.414 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(5), reckless_force_counter(18)
0:57.370 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), reckless_force_counter(18)
0:58.330 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), reckless_force_counter(18)
0:59.294 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(2), reckless_force_counter(18)
1:00.433 default K starsurge Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(5), lunar_empowerment, torrent_of_elements, overwhelming_power, reckless_force_counter(18)
1:01.675 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(18)
1:02.888 default H the_unbound_force Fluffy_Pillow 4.5/100: 5% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements
1:04.066 default N sunfire Fluffy_Pillow 5.5/100: 6% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
1:05.146 default O moonfire Fluffy_Pillow 9.0/100: 9% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23)
1:06.230 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22)
1:07.616 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), reckless_force_counter
1:09.008 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), reckless_force_counter
1:10.407 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), reckless_force_counter
1:11.510 default P stellar_flare Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17), reckless_force_counter(2)
1:12.587 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), reckless_force_counter(3)
1:13.505 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(3)
1:14.888 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(3)
1:15.814 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(3)
1:16.742 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(4)
1:18.137 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(10), reckless_force_counter(5)
1:19.241 default N sunfire Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(9), reckless_force_counter(5)
1:20.350 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(8), reckless_force_counter(6)
1:20.350 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(8), overwhelming_power(8), reckless_force_counter(6)
1:21.560 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7), reckless_force_counter(6)
1:22.435 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(6), reckless_force_counter(7)
1:23.467 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(5), reckless_force_counter(8)
1:24.321 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(4), reckless_force_counter(9)
1:25.329 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(3), reckless_force_counter(9)
1:26.166 default M moonfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(2), reckless_force_counter(9)
1:27.155 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power, reckless_force_counter(9)
1:28.609 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), reckless_force_counter(9)
1:30.067 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), reckless_force_counter(9)
1:31.213 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(10)
1:32.672 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(10)
1:34.130 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), reckless_force_counter(12)
1:35.277 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), reckless_force_counter(13)
1:36.423 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(13)
1:37.568 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(13)
1:39.027 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), reckless_force_counter(13)
1:39.999 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), reckless_force_counter(13)
1:40.972 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, reckless_force_counter(13)
1:42.563 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(4), solar_empowerment, reckless_force_counter(14)
1:43.810 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(14)
1:45.355 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, reckless_force_counter(15)
1:46.386 default O moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), solar_empowerment, starlord, reckless_force_counter(15)
1:47.601 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), solar_empowerment, starlord, reckless_force_counter(15)
1:48.815 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(16)
1:50.315 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), reckless_force_counter(18)
1:51.315 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), reckless_force_counter(18)
1:52.317 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), reckless_force_counter(18)
1:53.320 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), starlord(2), reckless_force_counter(18)
1:54.496 default N sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18)
1:55.642 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(18)
1:57.101 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(19)
1:58.074 default P stellar_flare Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(19)
1:59.221 default H the_unbound_force Fluffy_Pillow 39.0/100: 39% astral_power reckless_force, arcanic_pulsar(7), starlord(3)
2:00.369 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power reckless_force, arcanic_pulsar(7), starlord(3), reckless_force_counter
2:01.514 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power reckless_force, arcanic_pulsar(7), starlord(3), reckless_force_counter
2:02.659 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment, reckless_force_counter, conch_of_dark_whispers
2:03.907 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(2), conch_of_dark_whispers
2:05.450 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(3), conch_of_dark_whispers
2:06.996 default G use_items Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, reckless_force_counter(3), conch_of_dark_whispers
2:06.996 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse
2:08.159 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse
2:08.996 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse
2:10.245 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, solar_empowerment, starlord(2), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse
2:11.229 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.011 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.181 default M moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), reckless_force_counter(5), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.100 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), reckless_force_counter(6), conch_of_dark_whispers, ignition_mages_fuse(2)
2:15.156 default N sunfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(6), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.173 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), reckless_force_counter(7), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.972 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(8), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.169 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(8), ignition_mages_fuse(3)
2:18.974 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(8), ignition_mages_fuse(3)
2:20.178 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(8), ignition_mages_fuse(4)
2:20.951 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(8), ignition_mages_fuse(4)
2:22.108 default P stellar_flare Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), reckless_force_counter(9), ignition_mages_fuse(4)
2:23.024 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(2), solar_empowerment, torrent_of_elements, overwhelming_power(21), reckless_force_counter(9), ignition_mages_fuse(5)
2:23.993 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(21), reckless_force_counter(9), ignition_mages_fuse(5)
2:25.190 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(19), reckless_force_counter(11), ignition_mages_fuse(5)
2:26.134 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(18), reckless_force_counter(11), ignition_mages_fuse(5)
2:26.917 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), reckless_force_counter(12), ignition_mages_fuse(5)
2:28.089 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), reckless_force_counter(12)
2:29.032 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), reckless_force_counter(12)
2:30.148 default O moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(12)
2:31.237 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), reckless_force_counter(12)
2:32.329 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), reckless_force_counter(12)
2:33.725 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), reckless_force_counter(12)
2:34.616 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(12)
2:35.665 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(12)
2:37.010 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(21), reckless_force_counter(12)
2:37.911 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(13)
2:38.813 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(13)
2:39.718 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(19), reckless_force_counter(13)
2:40.787 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(18), reckless_force_counter(15)
2:41.859 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(17), reckless_force_counter(15)
2:42.935 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power(16), reckless_force_counter(15)
2:44.311 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(6), overwhelming_power(14), reckless_force_counter(15)
2:45.497 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), reckless_force_counter(15)
2:46.652 default P stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), reckless_force_counter(15)
2:47.780 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(11), reckless_force_counter(16)
2:49.221 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), reckless_force_counter(16)
2:50.359 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(8), reckless_force_counter(17)
2:51.815 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(7), reckless_force_counter(18)
2:52.961 default O moonfire Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(6), reckless_force_counter(18)
2:53.934 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5), reckless_force_counter(18)
2:54.764 default H the_unbound_force Fluffy_Pillow 34.5/100: 35% astral_power reckless_force, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
2:55.745 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power reckless_force, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3)
2:56.583 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power reckless_force, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(2)
2:57.574 default L sunfire Fluffy_Pillow 4.0/100: 4% astral_power reckless_force, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power
2:58.566 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power reckless_force, arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:00.026 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter
3:01.486 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), reckless_force_counter
3:02.460 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment, starlord(3), reckless_force_counter
3:03.433 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), reckless_force_counter
3:04.892 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, reckless_force_counter
3:06.140 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter
3:07.684 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), solar_empowerment, starlord, reckless_force_counter
3:08.715 default I celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(2), celestial_alignment, starlord, reckless_force_counter
3:09.770 default E potion Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(2), celestial_alignment, starlord, reckless_force_counter(2)
3:09.770 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(2), celestial_alignment, starlord, reckless_force_counter(2), battle_potion_of_intellect
3:09.770 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord, reckless_force_counter(2), battle_potion_of_intellect
3:10.728 default P stellar_flare Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(24), reckless_force_counter(2), battle_potion_of_intellect
3:11.583 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(23), reckless_force_counter(3), battle_potion_of_intellect
3:12.441 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(3), battle_potion_of_intellect
3:13.195 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), reckless_force_counter(3), battle_potion_of_intellect
3:14.265 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(3), battle_potion_of_intellect
3:15.109 default O moonfire Fluffy_Pillow 3.0/100: 3% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(3), battle_potion_of_intellect
3:15.953 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(3), battle_potion_of_intellect
3:16.799 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(3), battle_potion_of_intellect
3:17.553 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), reckless_force_counter(4), battle_potion_of_intellect
3:18.608 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(6), battle_potion_of_intellect
3:19.364 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter(7), battle_potion_of_intellect
3:20.426 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power berserking, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(7), battle_potion_of_intellect
3:21.180 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(21), reckless_force_counter(7), battle_potion_of_intellect
3:22.438 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(20), reckless_force_counter(7), battle_potion_of_intellect
3:23.364 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(19), reckless_force_counter(7), battle_potion_of_intellect
3:23.364 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(5), celestial_alignment, overwhelming_power(19), reckless_force_counter(7), battle_potion_of_intellect
3:24.377 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), reckless_force_counter(7), battle_potion_of_intellect
3:25.217 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(17), reckless_force_counter(7), battle_potion_of_intellect
3:26.207 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(16), reckless_force_counter(8), battle_potion_of_intellect
3:27.028 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter(8), battle_potion_of_intellect
3:28.264 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(14), reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:29.239 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:30.632 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:32.030 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(10), reckless_force_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:32.969 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(10), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:34.072 default N sunfire Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(8), reckless_force_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:35.185 default P stellar_flare Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(7), reckless_force_counter(9), conch_of_dark_whispers
3:36.301 default O moonfire Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(6), reckless_force_counter(9), conch_of_dark_whispers
3:37.421 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(5), reckless_force_counter(9), conch_of_dark_whispers
3:38.546 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(4), reckless_force_counter(9), conch_of_dark_whispers
3:39.676 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(3), reckless_force_counter(9), conch_of_dark_whispers
3:40.811 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), reckless_force_counter(10), conch_of_dark_whispers
3:41.588 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter(10), conch_of_dark_whispers
3:42.757 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment, starlord(3), overwhelming_power(22), reckless_force_counter(10), conch_of_dark_whispers
3:42.757 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power celestial_alignment, overwhelming_power(22), reckless_force_counter(10), conch_of_dark_whispers
3:43.760 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), reckless_force_counter(11), conch_of_dark_whispers
3:44.594 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, overwhelming_power(20), reckless_force_counter(11), conch_of_dark_whispers
3:45.574 default L sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(19), reckless_force_counter(11), conch_of_dark_whispers
3:46.531 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), reckless_force_counter(11), conch_of_dark_whispers
3:47.936 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17), reckless_force_counter(11), conch_of_dark_whispers
3:49.346 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter(11), conch_of_dark_whispers
3:50.461 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), reckless_force_counter(11), conch_of_dark_whispers
3:51.388 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), reckless_force_counter(12), conch_of_dark_whispers
3:52.780 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(12), reckless_force_counter(12), conch_of_dark_whispers
3:53.714 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(11), reckless_force_counter(12), conch_of_dark_whispers
3:54.814 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(12), conch_of_dark_whispers
3:56.221 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(8), reckless_force_counter(12)
3:57.166 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(7), reckless_force_counter(12)
3:58.115 default O moonfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(6), reckless_force_counter(13)
3:59.236 default P stellar_flare Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(5), reckless_force_counter(13)
4:00.358 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(4), reckless_force_counter(13)
4:01.486 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(3), reckless_force_counter(13)
4:02.617 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), overwhelming_power(2), reckless_force_counter(13)
4:04.065 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(4), reckless_force_counter(13)
4:05.314 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(13)
4:06.527 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(13)
4:07.706 default G use_items Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(13)
4:07.706 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(13), ignition_mages_fuse
4:09.146 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(13), ignition_mages_fuse
4:10.585 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), reckless_force_counter(14), ignition_mages_fuse
4:11.717 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(14), ignition_mages_fuse(2)
4:12.615 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(15), ignition_mages_fuse(2)
4:13.958 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(15), ignition_mages_fuse(2)
4:14.855 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(15), ignition_mages_fuse(2)
4:15.753 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), reckless_force_counter(16), ignition_mages_fuse(3)
4:16.768 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(16), ignition_mages_fuse(3)
4:18.064 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(17), ignition_mages_fuse(3)
4:19.360 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(17), ignition_mages_fuse(3)
4:20.225 default O moonfire Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(17), ignition_mages_fuse(4)
4:21.204 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(17), ignition_mages_fuse(4)
4:22.036 default N sunfire Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), starlord(3), reckless_force_counter(17), ignition_mages_fuse(4)
4:23.016 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), starlord(3), reckless_force_counter(17), ignition_mages_fuse(4)
4:23.997 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), starlord(3), reckless_force_counter(18), ignition_mages_fuse(5)
4:24.941 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(8), reckless_force_counter(18), ignition_mages_fuse(5)
4:25.973 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(18), ignition_mages_fuse(5)
4:26.728 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power celestial_alignment, lunar_empowerment, starlord, reckless_force_counter(18), ignition_mages_fuse(5)
4:27.598 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(18), ignition_mages_fuse(5)
4:28.352 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), reckless_force_counter(19)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

visions : 39603 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39603.1 39603.1 39.6 / 0.100% 6925.9 / 17.5% 4628.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.4 Astral Power 0.00% 59.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 39603
Heed My Call 300 (428) 0.8% (1.1%) 8.3 33.34sec 15511 0 Direct 8.3 9198 18384 10861 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 89872.16 89872.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.78 81.89% 9197.66 8987 9886 9196.19 0 9886 62325 62325 0.00
crit 1.50 18.11% 18384.18 17974 19771 14532.31 0 19771 27547 27547 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.3 33.34sec 4650 0 Direct 8.3 3942 7881 4650 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 38476.97 38476.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.79 82.02% 3941.68 3852 4237 3942.25 3852 4237 26751 26751 0.00
crit 1.49 17.98% 7880.53 7703 8473 6138.70 0 8473 11726 11726 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5288 13.3% 78.9 3.71sec 20063 15563 Direct 78.9 17007 33993 20062 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.93 78.93 0.00 0.00 1.2891 0.0000 1583572.06 1583572.06 0.00 15563.36 15563.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.73 82.01% 17007.19 8968 21459 17009.13 16114 18007 1100910 1100910 0.00
crit 14.20 17.99% 33992.62 17937 42918 33990.99 29825 38320 482662 482662 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2565 6.5% 14.3 21.22sec 53883 53453 Direct 14.3 2908 5815 3428 17.9%  
Periodic 225.5 2706 5407 3189 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.25 14.25 225.48 225.48 1.0081 1.3192 768012.14 768012.14 0.00 2463.05 53452.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.70 82.10% 2907.89 2614 3599 2908.04 2694 3160 34028 34028 0.00
crit 2.55 17.90% 5815.38 5227 7198 5457.03 0 7198 14837 14837 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.1 82.09% 2705.57 2 3351 2705.75 2608 2837 500787 500787 0.00
crit 40.4 17.91% 5407.23 26 6702 5407.72 5018 5812 218359 218359 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 834 2.1% 45.1 6.51sec 5543 0 Direct 45.1 4696 9391 5542 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.06 45.06 0.00 0.00 0.0000 0.0000 249735.47 249735.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.94 81.98% 4696.32 4220 5812 4696.75 4405 5033 173470 173470 0.00
crit 8.12 18.02% 9391.10 8441 11624 9388.73 0 11624 76265 76265 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2946 (4704) 7.4% (11.9%) 94.3 3.12sec 14937 16846 Direct 94.9 7886 15756 9295 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.34 94.90 0.00 0.00 0.8866 0.0000 882173.35 882173.35 0.00 16846.34 16846.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.91 82.09% 7885.91 7034 9687 7887.45 7567 8303 614380 614380 0.00
crit 17.00 17.91% 15755.76 14068 19373 15758.10 14373 17786 267793 267793 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1759 4.4% 77.5 3.79sec 6803 0 Direct 77.5 6803 0 6803 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.46 77.46 0.00 0.00 0.0000 0.0000 526989.44 526989.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.46 100.00% 6802.81 5135 14142 6803.28 5991 8029 526989 526989 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5905.03
  • base_dd_max:5905.03
  • base_dd_mult:1.00
 
Starsurge 12751 32.2% 64.1 4.72sec 59590 57631 Direct 63.9 50722 101359 59812 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.09 63.85 0.00 0.00 1.0340 0.0000 3819079.77 3819079.77 0.00 57630.83 57630.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.39 82.05% 50722.12 45503 62210 50720.53 48582 53590 2657310 2657310 0.00
crit 11.46 17.95% 101358.89 91007 124420 101341.09 91007 115830 1161770 1161770 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1664 4.2% 12.8 23.57sec 39007 37806 Direct 12.8 2475 4949 2920 18.0%  
Periodic 223.1 1753 3504 2068 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 12.78 223.08 223.08 1.0318 1.3219 498551.27 498551.27 0.00 1618.32 37806.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.48 82.02% 2475.14 2253 3103 2475.59 2253 2758 25946 25946 0.00
crit 2.30 17.98% 4949.11 4506 6205 4529.32 0 6205 11375 11375 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.0 82.05% 1753.48 2 2172 1753.61 1696 1839 320961 320961 0.00
crit 40.0 17.95% 3503.53 24 4344 3503.53 3263 3773 140270 140270 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 8513 21.5% 131.1 2.20sec 19472 0 Direct 131.1 16517 33030 19472 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.13 131.13 0.00 0.00 0.0000 0.0000 2553400.86 2553400.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.66 82.10% 16516.53 16140 17753 16516.18 16140 17330 1778205 1778205 0.00
crit 23.47 17.90% 33030.39 32279 35507 33032.33 32279 35507 775196 775196 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2855 7.2% 18.0 16.68sec 47537 47104 Direct 18.0 4019 8046 4744 18.0%  
Periodic 224.6 2906 5810 3427 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.99 17.99 224.60 224.60 1.0092 1.3202 854989.15 854989.15 0.00 2717.05 47104.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.75 82.00% 4018.99 3605 4964 4018.87 3762 4343 59273 59273 0.00
crit 3.24 18.00% 8046.10 7210 9929 7812.56 0 9929 26051 26051 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.3 82.05% 2905.69 2 3599 2905.92 2789 3036 535488 535488 0.00
crit 40.3 17.95% 5809.65 14 7198 5809.55 5450 6310 234177 234177 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 188.26sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.4 154.63sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.37 0.00 0.00 0.00 0.9078 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.388
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.3 42.5sec 4.7sec 93.09% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.33%
  • arcanic_pulsar_2:10.86%
  • arcanic_pulsar_3:11.52%
  • arcanic_pulsar_4:10.74%
  • arcanic_pulsar_5:13.10%
  • arcanic_pulsar_6:11.01%
  • arcanic_pulsar_7:11.07%
  • arcanic_pulsar_8:13.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 111.6sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 188.4sec 188.4sec 8.12% 8.17% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 10.0 0.0 31.0sec 31.0sec 38.86% 46.60% 0.0(0.0) 9.5

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:38.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.1sec 45.7sec 23.59% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.4 0.0 154.7sec 154.7sec 15.21% 0.00% 2.2(2.2) 2.2

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:3.00%
  • ignition_mages_fuse_5:2.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 28.8 54.5 10.4sec 3.6sec 85.87% 98.98% 3.4(3.4) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:32.03%
  • lunar_empowerment_2:32.97%
  • lunar_empowerment_3:20.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.4sec 33.6sec 48.03% 0.00% 3.5(49.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.8 52.1 10.7sec 3.8sec 84.82% 81.71% 0.3(0.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.31%
  • solar_empowerment_2:38.17%
  • solar_empowerment_3:16.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 48.7 20.1sec 4.7sec 97.96% 92.97% 18.3(18.3) 10.6

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.12%
  • starlord_2:21.95%
  • starlord_3:61.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.9sec 45.3sec 23.68% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.68%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vision of Perfection 4.1 0.6 60.8sec 51.4sec 14.24% 0.00% 0.6(0.6) 3.9

Buff details

  • buff initial source:visions
  • cooldown name:buff_vision_of_perfection
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:116.09

Stack Uptimes

  • vision_of_perfection_1:14.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303344
  • name:Vision of Perfection
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc303342=When Vision of Perfection activates, you and {$s1=2} other nearby allies gain {$s2=0} Haste for {$303344d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 64.1 2563.5 40.0 40.0 1489.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.34 762.19 (30.16%) 7.99 0.55 0.07%
celestial_alignment Astral Power 2.37 94.82 (3.75%) 40.00 0.00 0.00%
sunfire Astral Power 17.99 53.96 (2.13%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.06 180.19 (7.13%) 4.00 0.03 0.02%
moonfire Astral Power 14.25 42.76 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.78 102.23 (4.04%) 8.00 0.02 0.02%
lunar_strike Astral Power 78.93 946.64 (37.45%) 11.99 0.52 0.06%
natures_balance Astral Power 400.03 200.00 (7.91%) 0.50 0.01 0.01%
arcanic_pulsar Astral Power 6.65 79.84 (3.16%) 12.00 0.00 0.00%
vision_of_perfection Astral Power 4.64 64.87 (2.57%) 13.97 0.12 0.18%
Resource RPS-Gain RPS-Loss
Astral Power 8.44 8.56
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.53 0.00 88.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data visions Damage Per Second
Count 7592
Mean 39603.12
Minimum 34318.41
Maximum 46513.02
Spread ( max - min ) 12194.61
Range [ ( max - min ) / 2 * 100% ] 15.40%
Standard Deviation 1758.7943
5th Percentile 36858.09
95th Percentile 42720.58
( 95th Percentile - 5th Percentile ) 5862.49
Mean Distribution
Standard Deviation 20.1854
95.00% Confidence Intervall ( 39563.55 - 39642.68 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7577
0.1 Scale Factor Error with Delta=300 26407
0.05 Scale Factor Error with Delta=300 105627
0.01 Scale Factor Error with Delta=300 2640668
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 7592
Mean 39603.12
Minimum 34318.41
Maximum 46513.02
Spread ( max - min ) 12194.61
Range [ ( max - min ) / 2 * 100% ] 15.40%
Standard Deviation 1758.7943
5th Percentile 36858.09
95th Percentile 42720.58
( 95th Percentile - 5th Percentile ) 5862.49
Mean Distribution
Standard Deviation 20.1854
95.00% Confidence Intervall ( 39563.55 - 39642.68 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7577
0.1 Scale Factor Error with Delta=300 26407
0.05 Scale Factor Error with Delta=300 105627
0.01 Scale Factor Error with Delta=300 2640668
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 7592
Mean 39603.12
Minimum 34318.41
Maximum 46513.02
Spread ( max - min ) 12194.61
Range [ ( max - min ) / 2 * 100% ] 15.40%
Damage
Sample Data visions Damage
Count 7592
Mean 11864852.63
Minimum 8774216.31
Maximum 15743121.39
Spread ( max - min ) 6968905.09
Range [ ( max - min ) / 2 * 100% ] 29.37%
DTPS
Sample Data visions Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.36 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.37 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.80 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.09 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.66 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.19 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 13.77 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.07 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 79.23 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.60 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.55 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQJQPQJQPMQPNQPQJOJQPJQPQPQPQKQJQJQPQPQIJJNPPJOQPQJMQPPQQPIJJNPPJQMEQPOQPJQPQIJQJQLJPPMJQPQPJKOQPJQPPJNQPQJQPMQQQQJOJQPJLQPPQJMQPQPQIJKPPJOQPJNQPJQPPMJQHGJQPJQPJOQNQPJQPMQPJQJQPJQPLPJQPOMPQPQJQFQPJQPJQPJQPJQLMOPQPJQPJKPJPQPNPQJQPPOJMQPJQPJQPJNQPPPMQJQJQPJQP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.250 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.185 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:03.118 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:04.055 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:04.868 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:04.868 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:04.868 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:05.623 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:06.377 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:07.132 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:07.885 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.738 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.492 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.247 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.001 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.809 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.563 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.316 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.069 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.849 default M sunfire Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.603 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.356 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.137 default N moonfire Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.893 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.648 default P lunar_strike Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.474 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.228 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.983 default O stellar_flare Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.738 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.491 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.245 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.075 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.830 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.585 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
0:26.560 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
0:27.317 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
0:28.296 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
0:29.064 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers
0:30.041 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, starlord(3), conch_of_dark_whispers
0:30.809 default K sunfire Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, starlord(3), conch_of_dark_whispers
0:31.576 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
0:32.459 default J starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
0:33.341 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
0:34.095 default J starsurge Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
0:34.861 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
0:35.617 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
0:36.595 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
0:37.349 default P lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:38.246 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:39.000 default I cancel_buff Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:39.000 default J starsurge Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, overwhelming_power(24), conch_of_dark_whispers
0:39.767 default J starsurge Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24), conch_of_dark_whispers
0:40.624 default N moonfire Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(23)
0:41.459 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22)
0:42.843 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21)
0:44.235 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19)
0:45.337 default O stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18)
0:46.410 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17)
0:47.327 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
0:48.702 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
0:49.623 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
0:50.711 default M sunfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13)
0:51.804 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12)
0:52.737 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
0:54.139 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
0:55.477 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:56.374 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(22)
0:57.272 default P lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(21)
0:58.622 default I cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(20)
0:58.622 default J starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(5), overwhelming_power(20)
0:59.784 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19)
1:00.916 default N moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18)
1:02.019 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
1:03.437 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
1:04.859 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(14)
1:05.975 default Q solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13)
1:06.904 default M sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25)
1:07.951 default E potion Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), vision_of_perfection
1:07.951 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), vision_of_perfection, battle_potion_of_intellect
1:08.719 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), vision_of_perfection, battle_potion_of_intellect
1:09.873 default O stellar_flare Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(22), vision_of_perfection, battle_potion_of_intellect
1:10.781 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(21), vision_of_perfection, battle_potion_of_intellect
1:11.556 default P lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), vision_of_perfection, battle_potion_of_intellect
1:12.720 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), celestial_alignment, starlord(3), overwhelming_power(19), vision_of_perfection, battle_potion_of_intellect
1:13.640 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), vision_of_perfection, battle_potion_of_intellect
1:14.423 default P lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), vision_of_perfection, battle_potion_of_intellect
1:15.600 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(16), vision_of_perfection, battle_potion_of_intellect
1:16.389 default I cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power celestial_alignment, starlord(3), overwhelming_power(15), vision_of_perfection, battle_potion_of_intellect
1:16.389 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power celestial_alignment, overwhelming_power(15), vision_of_perfection, battle_potion_of_intellect
1:17.404 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:18.244 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
1:19.249 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
1:20.083 default L moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
1:21.069 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(2), overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect
1:22.205 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers, battle_potion_of_intellect
1:23.615 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
1:25.030 default M sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), conch_of_dark_whispers, battle_potion_of_intellect
1:26.151 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:27.115 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:27.940 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(4), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:29.173 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:30.002 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:31.249 default J starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers, battle_potion_of_intellect
1:32.230 default K sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection, battle_potion_of_intellect
1:33.212 default O stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection
1:34.340 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), vision_of_perfection
1:35.301 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection
1:36.739 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), torrent_of_elements
1:37.987 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements
1:39.017 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:40.561 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
1:42.106 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, torrent_of_elements
1:43.317 default N moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:44.496 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:45.499 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:46.999 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), torrent_of_elements
1:48.001 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements
1:49.179 default Q solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
1:50.151 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:51.610 default M sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
1:52.755 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
1:53.729 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
1:54.703 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
1:55.848 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
1:56.993 default J starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), torrent_of_elements
1:58.240 default O stellar_flare Fluffy_Pillow 48.5/100: 49% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:59.294 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
2:00.349 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:01.222 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers
2:02.530 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:03.553 default L moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:04.549 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:05.522 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
2:06.856 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
2:08.194 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), overwhelming_power(22), conch_of_dark_whispers
2:09.092 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
2:10.154 default M sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), vision_of_perfection, conch_of_dark_whispers
2:11.068 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(19), vision_of_perfection, conch_of_dark_whispers
2:11.846 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), vision_of_perfection, conch_of_dark_whispers
2:13.015 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), vision_of_perfection, conch_of_dark_whispers
2:13.800 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), vision_of_perfection, conch_of_dark_whispers
2:14.977 default Q solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), vision_of_perfection
2:15.766 default I cancel_buff Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), vision_of_perfection
2:15.766 default J starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, overwhelming_power(15), vision_of_perfection
2:16.782 default K sunfire Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(14), vision_of_perfection
2:17.771 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(13), vision_of_perfection
2:19.222 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(11), vision_of_perfection
2:20.684 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(10)
2:21.853 default O stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(9)
2:22.994 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(8)
2:23.966 default P lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7)
2:25.427 default J starsurge Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5)
2:26.583 default N moonfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:27.712 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers
2:28.673 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
2:30.121 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:31.266 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:32.240 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:33.701 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:35.160 default M sunfire Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:36.306 default J starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(7), solar_empowerment(2), conch_of_dark_whispers
2:37.555 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, conch_of_dark_whispers
2:38.587 default H celestial_alignment Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
2:39.641 default G use_items Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
2:39.641 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers, ignition_mages_fuse
2:40.652 default Q solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:41.489 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:42.740 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
2:43.723 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
2:44.506 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:45.677 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:46.598 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
2:47.517 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
2:48.298 default N moonfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:49.181 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:49.935 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:51.062 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(3)
2:51.948 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:52.702 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:53.788 default M sunfire Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:54.639 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:55.392 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:56.479 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, torrent_of_elements, ignition_mages_fuse(5)
2:57.375 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(5)
2:58.129 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(5)
2:58.999 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
2:59.753 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements
3:01.057 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements
3:02.082 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
3:02.930 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
3:04.200 default L moonfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
3:05.196 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3)
3:06.655 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
3:07.801 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:08.773 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3)
3:10.232 default O stellar_flare Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:11.378 default M sunfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:12.522 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:13.981 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
3:14.956 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
3:16.415 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3)
3:17.388 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2)
3:18.636 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord
3:19.666 default F berserking Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, vision_of_perfection
3:19.666 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, vision_of_perfection
3:20.469 default P lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, vision_of_perfection, conch_of_dark_whispers
3:21.673 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, vision_of_perfection, conch_of_dark_whispers
3:22.618 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power berserking, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), vision_of_perfection, conch_of_dark_whispers
3:23.398 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power berserking, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers
3:24.568 default J starsurge Fluffy_Pillow 81.0/100: 81% astral_power berserking, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers
3:25.488 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, vision_of_perfection, conch_of_dark_whispers
3:26.249 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), vision_of_perfection, conch_of_dark_whispers
3:27.294 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), vision_of_perfection, conch_of_dark_whispers
3:28.111 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), vision_of_perfection, conch_of_dark_whispers
3:28.865 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), vision_of_perfection, conch_of_dark_whispers
3:29.911 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
3:30.746 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
3:31.500 default L moonfire Fluffy_Pillow 18.0/100: 18% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
3:32.340 default M sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
3:33.406 default O stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
3:34.477 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
3:35.843 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), vision_of_perfection
3:36.630 default P lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), vision_of_perfection
3:37.812 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(15), vision_of_perfection
3:38.826 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(14), vision_of_perfection
3:39.664 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(13), vision_of_perfection
3:40.926 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(12), vision_of_perfection
3:41.923 default K sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(11), vision_of_perfection
3:42.894 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(10), vision_of_perfection
3:44.320 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(8), vision_of_perfection
3:45.448 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(7), vision_of_perfection
3:46.851 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers
3:47.804 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
3:49.235 default N moonfire Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers
3:50.367 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
3:51.816 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers
3:52.787 default J starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:53.933 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
3:54.907 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:56.366 default P lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:57.827 default O stellar_flare Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), conch_of_dark_whispers
3:59.075 default J starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), conch_of_dark_whispers
4:00.324 default M sunfire Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord, conch_of_dark_whispers
4:01.537 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord, conch_of_dark_whispers
4:02.567 default P lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord
4:04.111 default J starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord
4:05.324 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
4:06.196 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:07.503 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
4:08.529 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:09.376 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:10.647 default J starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
4:11.644 default N moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:12.789 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:13.762 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
4:15.221 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:16.682 default P lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
4:18.141 default M sunfire Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3)
4:19.287 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), solar_empowerment(3)
4:20.347 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(2), solar_empowerment(2)
4:21.595 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord
4:22.627 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord
4:23.841 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2)
4:24.841 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
4:26.342 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
4:27.520 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:28.494 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 5.59% 5.59% 475
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

worldvein : 36735 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36735.3 36735.3 25.6 / 0.070% 4383.0 / 11.9% 4545.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 36735
Heed My Call 293 (419) 0.8% (1.1%) 8.2 33.11sec 15355 0 Direct 8.2 9107 18218 10738 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 87820.77 87820.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 82.11% 9107.31 8901 9791 9104.04 0 9791 61161 61161 0.00
crit 1.46 17.89% 18218.02 17802 19582 14164.24 0 19582 26660 26660 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 126 0.3% 8.2 33.11sec 4617 0 Direct 8.2 3904 7803 4617 18.3%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 37763.89 37763.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 81.70% 3903.66 3815 4196 3903.92 3815 4196 26085 26085 0.00
crit 1.50 18.30% 7802.93 7629 8392 6117.65 0 8392 11679 11679 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5330 14.5% 76.0 3.84sec 20994 16040 Direct 76.0 17794 35586 20993 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.01 76.01 0.00 0.00 1.3088 0.0000 1595720.30 1595720.30 0.00 16039.97 16039.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.34 82.02% 17794.44 9215 22717 17801.50 17123 18669 1109338 1109338 0.00
crit 13.67 17.98% 35586.49 19095 45434 35597.69 32243 41349 486382 486382 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2619 7.1% 14.1 21.31sec 55744 54581 Direct 14.1 3058 6114 3607 18.0%  
Periodic 220.6 2818 5632 3323 17.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 220.62 220.62 1.0213 1.3439 783832.68 783832.68 0.00 2521.64 54580.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 82.05% 3058.40 2637 3810 3059.87 2813 3346 35284 35284 0.00
crit 2.52 17.95% 6113.96 5274 7620 5719.94 0 7620 15434 15434 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.0 82.05% 2817.96 2 3547 2819.19 2732 2944 510102 510102 0.00
crit 39.6 17.95% 5631.74 20 7095 5633.93 5196 6107 223012 223012 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 849 2.3% 44.1 6.64sec 5765 0 Direct 44.1 4888 9769 5764 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.07 44.07 0.00 0.00 0.0000 0.0000 254027.19 254027.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.15 82.04% 4887.86 4258 6153 4889.80 4616 5354 176708 176708 0.00
crit 7.91 17.96% 9769.21 8516 12305 9768.32 0 11933 77319 77319 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2961 (4692) 8.1% (12.8%) 91.3 3.22sec 15377 17065 Direct 91.9 8189 16366 9649 17.8%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.34 91.86 0.00 0.00 0.9010 0.0000 886306.26 886306.26 0.00 17065.34 17065.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.46 82.15% 8189.42 6967 10255 8194.15 7907 8646 617970 617970 0.00
crit 16.40 17.85% 16366.36 13933 20509 16375.75 14977 19816 268336 268336 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1731 4.7% 73.3 3.99sec 7069 0 Direct 73.3 7069 0 7069 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.30 73.30 0.00 0.00 0.0000 0.0000 518171.21 518171.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.30 100.00% 7069.06 5086 14972 7072.51 6219 8387 518171 518171 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12026.29
  • base_dd_max:12026.29
  • base_dd_mult:1.00
 
Starsurge 12464 33.9% 60.4 4.99sec 61723 58738 Direct 60.2 52480 104853 61908 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.41 60.23 0.00 0.00 1.0508 0.0000 3728952.78 3728952.78 0.00 58738.47 58738.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.39 82.00% 52480.37 45067 65508 52503.93 50464 55807 2592102 2592102 0.00
crit 10.84 18.00% 104853.14 90135 131016 104885.62 95518 125292 1136851 1136851 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1699 4.6% 12.7 23.57sec 39933 38458 Direct 12.7 2567 5132 3029 18.0%  
Periodic 218.3 1826 3651 2153 17.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.73 12.73 218.25 218.25 1.0384 1.3466 508528.52 508528.52 0.00 1655.78 38457.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.45 82.02% 2567.45 2231 3285 2568.44 2381 2794 26817 26817 0.00
crit 2.29 17.98% 5131.87 4463 6569 4709.76 0 6569 11748 11748 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.1 82.08% 1826.29 2 2299 1827.14 1779 1906 327151 327151 0.00
crit 39.1 17.92% 3650.70 19 4599 3651.88 3444 3916 142812 142812 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5745 15.6% 88.7 3.13sec 19279 0 Direct 88.7 16352 32708 19279 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.68 88.68 0.00 0.00 0.0000 0.0000 1709678.15 1709678.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.81 82.11% 16352.24 15985 17583 16351.67 15985 17225 1190649 1190649 0.00
crit 15.87 17.89% 32708.40 31970 35167 32706.89 31970 34921 519029 519029 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2917 7.9% 17.9 16.59sec 48698 47438 Direct 17.9 4194 8391 4941 17.8%  
Periodic 219.8 3027 6049 3569 18.0% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 219.77 219.77 1.0266 1.3449 872954.16 872954.16 0.00 2780.44 47438.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.73 82.20% 4194.13 3637 5255 4194.89 3892 4510 61799 61799 0.00
crit 3.19 17.80% 8391.46 7141 10511 8105.79 0 10511 26780 26780 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.3 82.05% 3026.60 2 3810 3027.98 2938 3154 545725 545725 0.00
crit 39.5 17.95% 6048.60 4 7620 6050.89 5715 6564 238651 238651 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.42sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.14sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9043 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Worldvein Resonance 5.5 60.36sec

Stats details: worldvein_resonance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 0.00 0.00 0.00 1.1470 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: worldvein_resonance

Static Values
  • id:295186
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295186
  • name:Worldvein Resonance
  • school:physical
  • tooltip:
  • description:Concentrate energy into the Heart of Azeroth, immediately causing {$s1=2} Lifeblood Shards to erupt from the nearby ground for {$295114d=12 seconds}. $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within {$295078s2=8} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.1 44.7sec 5.0sec 92.82% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.35%
  • arcanic_pulsar_2:10.31%
  • arcanic_pulsar_3:11.23%
  • arcanic_pulsar_4:10.65%
  • arcanic_pulsar_5:13.75%
  • arcanic_pulsar_6:10.38%
  • arcanic_pulsar_7:10.84%
  • arcanic_pulsar_8:14.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.12% 7.67% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.77% 32.51% 0.0(0.0) 8.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.5sec 23.70% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.21% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 94.0 0.0 153.8sec 3.2sec 99.98% 0.00% 84.2(97.4) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:190.14

Stack Uptimes

  • lifeblood_1:0.10%
  • lifeblood_2:0.85%
  • lifeblood_3:5.83%
  • lifeblood_4:93.20%

Trigger Attempt Success

  • trigger_pct:94.38%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.5 45.4 9.0sec 3.8sec 81.95% 99.68% 1.9(1.9) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.22%
  • lunar_empowerment_2:31.65%
  • lunar_empowerment_3:14.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.3sec 33.8sec 47.94% 0.00% 3.5(48.1) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.3 51.4 12.2sec 4.0sec 85.78% 79.93% 0.3(0.3) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.03%
  • solar_empowerment_2:39.66%
  • solar_empowerment_3:18.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.03% 92.04% 15.4(15.4) 11.4

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.89%
  • starlord_2:22.44%
  • starlord_3:59.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.6sec 23.61% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.61%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 60.4 2416.6 40.0 40.0 1543.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.34 738.66 (31.05%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.93 53.78 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.07 176.26 (7.41%) 4.00 0.01 0.00%
moonfire Astral Power 14.06 42.18 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.73 101.88 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.01 912.06 (38.34%) 12.00 0.06 0.01%
natures_balance Astral Power 400.03 200.01 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.19 74.34 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.80 0.00 85.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data worldvein Damage Per Second
Count 7592
Mean 36735.32
Minimum 33076.66
Maximum 40736.58
Spread ( max - min ) 7659.92
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 1137.4858
5th Percentile 34949.69
95th Percentile 38696.28
( 95th Percentile - 5th Percentile ) 3746.59
Mean Distribution
Standard Deviation 13.0547
95.00% Confidence Intervall ( 36709.74 - 36760.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3684
0.1 Scale Factor Error with Delta=300 11046
0.05 Scale Factor Error with Delta=300 44182
0.01 Scale Factor Error with Delta=300 1104526
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 7592
Mean 36735.32
Minimum 33076.66
Maximum 40736.58
Spread ( max - min ) 7659.92
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 1137.4858
5th Percentile 34949.69
95th Percentile 38696.28
( 95th Percentile - 5th Percentile ) 3746.59
Mean Distribution
Standard Deviation 13.0547
95.00% Confidence Intervall ( 36709.74 - 36760.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3684
0.1 Scale Factor Error with Delta=300 11046
0.05 Scale Factor Error with Delta=300 44182
0.01 Scale Factor Error with Delta=300 1104526
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 7592
Mean 36735.32
Minimum 33076.66
Maximum 40736.58
Spread ( max - min ) 7659.92
Range [ ( max - min ) / 2 * 100% ] 10.43%
Damage
Sample Data worldvein Damage
Count 7592
Mean 10983755.91
Minimum 8676538.32
Maximum 13485082.62
Spread ( max - min ) 4808544.30
Range [ ( max - min ) / 2 * 100% ] 21.89%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 thorns
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
H 5.46 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.76 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.41 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.04 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.77 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.53 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.29 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.73 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.38 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.60 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.35 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQRKRQKRQRNRORQRSKPKRLQQRKRQQRKRQKRQRQJKKORNQPQKRQKRQRQRQHKKNORQQKPRQQRRRRJKNKRKRMQQKRQQPRNQRKKQQORKRQRKQRNRRPRHKQKRGRKRQRMKQNQKRQQRRKPQKQRRKONQRRKQRRRRKQRPKRQRKRQNOQQRQHKKQQNIEFPKRKRORKRQRQRQRKRKRQKNRQRKMPQKQRQQKNRQKRQRKQORPRRHNKQGRKQRRRKQRQONRRPRJKRKRQK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H worldvein_resonance Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.250 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, lifeblood(3), battle_potion_of_intellect
0:02.212 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:03.144 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.080 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.013 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24), lifeblood(3), battle_potion_of_intellect
0:05.768 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24), lifeblood(3), battle_potion_of_intellect
0:05.768 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24), lifeblood(3), battle_potion_of_intellect
0:05.768 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.521 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(23), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.274 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(22), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.088 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(21), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.841 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.595 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.391 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.144 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.897 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.651 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.407 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.163 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.918 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.671 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.424 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.178 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.932 default O moonfire Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.688 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.445 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.223 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.980 default S sunfire Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.735 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(21), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.490 default P stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(20), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.244 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(19), lifeblood(4), ignition_mages_fuse(5)
0:23.999 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(19), lifeblood(4), ignition_mages_fuse(5)
0:24.753 default L sunfire Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(18), lifeblood(4), ignition_mages_fuse(5)
0:25.507 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(17), lifeblood(4), ignition_mages_fuse(5)
0:26.415 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), lifeblood(4)
0:27.507 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(15), lifeblood(4)
0:28.261 default K starsurge Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), lifeblood(4)
0:29.122 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13), lifeblood(4)
0:29.877 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), lifeblood(4)
0:30.948 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), lifeblood(4)
0:32.024 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(10), lifeblood(4)
0:32.779 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood(4)
0:33.629 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9), lifeblood(4)
0:34.384 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8), lifeblood(4)
0:35.333 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), lifeblood(4)
0:36.089 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), lifeblood(4)
0:36.844 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), lifeblood(4)
0:37.801 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), lifeblood(4)
0:38.555 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(4), lifeblood(4)
0:39.518 default J cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(3), lifeblood(4)
0:39.518 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, solar_empowerment, overwhelming_power(3), lifeblood(4)
0:40.469 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(2), lifeblood(4)
0:41.396 default O moonfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power, lifeblood(4)
0:42.569 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), lifeblood(4)
0:43.571 default N sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), lifeblood(4)
0:44.750 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers
0:46.251 default P stellar_flare Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4), conch_of_dark_whispers
0:47.428 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), lifeblood(4), conch_of_dark_whispers
0:48.799 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
0:49.879 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
0:50.776 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
0:52.123 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4), conch_of_dark_whispers
0:53.189 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(25), lifeblood(4), conch_of_dark_whispers
0:54.078 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
0:55.417 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), lifeblood(4), conch_of_dark_whispers
0:56.314 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood(4), conch_of_dark_whispers
0:57.662 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), conch_of_dark_whispers
0:58.565 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4), conch_of_dark_whispers
0:59.923 default H worldvein_resonance Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(19), lifeblood(4)
1:01.171 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(17), lifeblood(4)
1:02.345 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
1:03.488 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
1:04.601 default O moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
1:05.720 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
1:06.675 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), lifeblood(4), conch_of_dark_whispers
1:08.109 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), lifeblood(4), conch_of_dark_whispers
1:09.554 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4), conch_of_dark_whispers
1:10.694 default P stellar_flare Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8), lifeblood(4), conch_of_dark_whispers
1:11.805 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(7), lifeblood(4), conch_of_dark_whispers
1:12.753 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), lifeblood(4), conch_of_dark_whispers
1:14.180 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), lifeblood(4), conch_of_dark_whispers
1:15.619 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(3), lifeblood(4), conch_of_dark_whispers
1:16.582 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(2), lifeblood(4), conch_of_dark_whispers
1:17.549 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power, lifeblood(4)
1:18.692 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4)
1:19.839 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), starlord(3), lifeblood(4)
1:19.839 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), lifeblood(4)
1:21.088 default N sunfire Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
1:22.142 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
1:23.195 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
1:24.067 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(4)
1:25.091 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3)
1:25.940 default M moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(3)
1:26.936 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
1:28.395 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
1:29.856 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
1:31.000 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), conch_of_dark_whispers
1:31.974 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
1:33.432 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
1:34.893 default P stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
1:36.038 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
1:37.012 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
1:38.158 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(3), conch_of_dark_whispers
1:39.617 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), lifeblood(3), conch_of_dark_whispers
1:40.589 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(3), lifeblood(3), conch_of_dark_whispers
1:41.838 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, lifeblood(3)
1:43.050 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(3)
1:44.551 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(25), lifeblood(4)
1:45.922 default O moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), overwhelming_power(24), lifeblood(4)
1:47.003 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), overwhelming_power(22), lifeblood(4)
1:47.927 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(22), lifeblood(4)
1:49.015 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), lifeblood(4)
1:49.920 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(4)
1:51.255 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(4)
1:52.151 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(4)
1:53.207 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4)
1:54.559 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood(4)
1:55.466 default N sunfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood(4)
1:56.536 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood(4)
1:57.448 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(4)
1:58.497 default P stellar_flare Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(4)
1:59.547 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(4)
2:00.602 default H worldvein_resonance Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(22), lifeblood(4)
2:01.756 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(21), lifeblood(4)
2:02.912 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), lifeblood(4)
2:04.348 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), lifeblood(4)
2:05.483 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17), lifeblood(4)
2:06.302 default G use_items Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(16), lifeblood(4)
2:06.302 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(16), lifeblood(4), ignition_mages_fuse
2:07.092 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(15), lifeblood(4), ignition_mages_fuse
2:08.024 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse
2:08.799 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse
2:09.959 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25), lifeblood(4), ignition_mages_fuse
2:10.713 default M moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(4), ignition_mages_fuse(2)
2:11.562 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4), ignition_mages_fuse(2)
2:12.540 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), ignition_mages_fuse(2)
2:13.790 default N sunfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), ignition_mages_fuse(2)
2:14.776 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4), ignition_mages_fuse(3)
2:15.990 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4), ignition_mages_fuse(3)
2:16.947 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), lifeblood(4), ignition_mages_fuse(3)
2:17.763 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4), ignition_mages_fuse(3)
2:18.988 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), lifeblood(4), ignition_mages_fuse(4)
2:20.177 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse(4)
2:20.974 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse(4)
2:21.773 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), overwhelming_power(13), lifeblood(4), ignition_mages_fuse(4)
2:22.801 default P stellar_flare Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12), lifeblood(4), ignition_mages_fuse(5)
2:23.765 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), lifeblood(4), ignition_mages_fuse(5)
2:24.997 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), solar_empowerment, starlord, overwhelming_power(10), lifeblood(4), ignition_mages_fuse(5)
2:25.968 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4), ignition_mages_fuse(5)
2:27.175 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), lifeblood(4)
2:28.150 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(6), lifeblood(4)
2:29.127 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), starlord(2), torrent_of_elements, overwhelming_power(5), lifeblood(4)
2:30.284 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), lifeblood(4)
2:31.412 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), lifeblood(4)
2:32.545 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), lifeblood(4)
2:33.993 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(4)
2:34.886 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(4)
2:35.940 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(4)
2:36.998 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4)
2:38.351 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood(4)
2:39.262 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood(4)
2:40.336 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(17), lifeblood(4)
2:41.413 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(16), lifeblood(4)
2:42.493 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), overwhelming_power(15), lifeblood(4)
2:43.674 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), lifeblood(4)
2:45.142 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(12), lifeblood(4)
2:46.129 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, overwhelming_power(11), lifeblood(4)
2:47.292 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, overwhelming_power(10), lifeblood(4)
2:48.461 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(9), lifeblood(4)
2:49.302 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(24), lifeblood(4)
2:50.499 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(23), lifeblood(4)
2:51.302 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(22), lifeblood(4)
2:52.248 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(21), lifeblood(4)
2:53.034 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20), lifeblood(4)
2:54.215 default N sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4)
2:55.285 default O moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4)
2:56.358 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4)
2:57.728 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4)
2:59.105 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(14), lifeblood(4)
3:00.031 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(13), lifeblood(4)
3:01.422 default H worldvein_resonance Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar, starlord(3), overwhelming_power(12), lifeblood(4)
3:02.518 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar, overwhelming_power(11), lifeblood(4)
3:03.717 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(10), lifeblood(4)
3:04.886 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4)
3:06.337 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), lifeblood(4)
3:07.800 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(2), overwhelming_power(6), lifeblood(4)
3:08.952 default I celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(5), lifeblood(4)
3:09.960 default E potion Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(4), lifeblood(4)
3:09.960 default F berserking Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(4), lifeblood(4), battle_potion_of_intellect
3:09.960 default P stellar_flare Fluffy_Pillow 86.5/100: 87% astral_power berserking, arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(4), lifeblood(4), battle_potion_of_intellect
3:10.879 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power berserking, arcanic_pulsar(3), celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(3), lifeblood(4), battle_potion_of_intellect
3:11.800 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(2), lifeblood(4), battle_potion_of_intellect
3:12.564 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, lifeblood(4), battle_potion_of_intellect
3:13.467 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect
3:14.237 default O moonfire Fluffy_Pillow 33.0/100: 33% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect
3:15.070 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:15.823 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:16.658 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), lifeblood(4), battle_potion_of_intellect
3:17.412 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), lifeblood(4), battle_potion_of_intellect
3:18.482 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(4), battle_potion_of_intellect
3:19.237 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4), battle_potion_of_intellect
3:20.312 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), lifeblood(3), battle_potion_of_intellect
3:21.162 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), lifeblood(3), battle_potion_of_intellect
3:22.246 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), celestial_alignment, starlord(3), overwhelming_power(16), lifeblood(2), battle_potion_of_intellect
3:23.188 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(6), celestial_alignment, overwhelming_power(15), lifeblood(3), battle_potion_of_intellect
3:24.215 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), lifeblood(3), battle_potion_of_intellect
3:25.066 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(13), lifeblood(3), battle_potion_of_intellect
3:26.071 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(12), lifeblood(3), battle_potion_of_intellect
3:26.903 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(12), lifeblood(4), battle_potion_of_intellect
3:28.152 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(10), lifeblood(4), battle_potion_of_intellect
3:29.139 default N sunfire Fluffy_Pillow 14.0/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(9), lifeblood(3), battle_potion_of_intellect
3:30.104 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), lifeblood(3), battle_potion_of_intellect
3:30.925 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), lifeblood(3), battle_potion_of_intellect
3:32.159 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), lifeblood(3), battle_potion_of_intellect
3:33.132 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), lifeblood(3), battle_potion_of_intellect
3:34.111 default M moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), lifeblood(2), conch_of_dark_whispers, battle_potion_of_intellect
3:35.092 default P stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), lifeblood(4), conch_of_dark_whispers
3:36.225 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), lifeblood(4), conch_of_dark_whispers
3:37.674 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, lifeblood(4), conch_of_dark_whispers
3:38.815 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
3:40.273 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
3:41.247 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
3:42.709 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
3:44.169 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(2), solar_empowerment(2), lifeblood(4), conch_of_dark_whispers
3:45.417 default N sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4), conch_of_dark_whispers
3:46.631 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4), conch_of_dark_whispers
3:47.664 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4), conch_of_dark_whispers
3:49.208 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, lifeblood(4)
3:50.420 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), lifeblood(4)
3:51.422 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
3:52.923 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), lifeblood(4)
3:53.925 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), lifeblood(4)
3:55.101 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
3:56.559 default O moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), lifeblood(4)
3:57.705 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), lifeblood(4)
3:58.677 default P stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), lifeblood(4)
3:59.823 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), lifeblood(4)
4:00.796 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
4:01.941 default H worldvein_resonance Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
4:03.087 default N sunfire Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), starlord(3), lifeblood(4)
4:04.233 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(5), lifeblood(4)
4:05.483 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
4:07.027 default G use_items Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord, lifeblood(4)
4:07.027 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord, lifeblood(4), ignition_mages_fuse
4:08.015 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), starlord, lifeblood(4), ignition_mages_fuse
4:09.178 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), lifeblood(4), ignition_mages_fuse
4:10.618 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse
4:11.580 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
4:12.667 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
4:13.755 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
4:14.841 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
4:16.185 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
4:17.050 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
4:18.346 default O moonfire Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
4:19.361 default N sunfire Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(4)
4:20.340 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(4)
4:21.321 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(3), ignition_mages_fuse(4)
4:22.300 default P stellar_flare Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(4)
4:23.279 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
4:24.225 default J cancel_buff Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
4:24.225 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
4:25.256 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
4:26.011 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.882 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25), lifeblood(4), conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.637 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(24), lifeblood(4), conch_of_dark_whispers
4:28.832 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(23), lifeblood(4), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/thorns
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

Simulation & Raid Information

Iterations: 7598
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.7 )

Performance:

Total Events Processed: 233018625
Max Event Queue: 425
Sim Seconds: 2276743
CPU Seconds: 452.7813
Physical Seconds: 109.8323
Speed Up: 5028

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.64sec 0 299.65sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.63sec 0 299.65sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
base base heed_my_call 271685 87023 290 1.62 9110 18211 8.1 8.1 17.9% 0.0% 0.0% 0.0% 33.79sec 87023 299.65sec
base base heed_my_call_aoe 271686 37366 125 1.62 3904 7803 8.1 8.1 18.1% 0.0% 0.0% 0.0% 33.79sec 37366 299.65sec
base base lunar_strike 194153 1519036 5069 15.56 16571 33128 77.7 77.7 18.0% 0.0% 0.0% 0.0% 3.77sec 1519036 299.65sec
base base moonfire 8921 47317 158 2.81 2860 5721 14.0 14.0 17.8% 0.0% 0.0% 0.0% 21.40sec 734887 299.65sec
base base moonfire ticks -8921 687570 2292 44.33 2630 5255 14.0 221.7 18.0% 0.0% 0.0% 0.0% 21.40sec 734887 299.65sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
base base shooting_stars 202497 237889 794 8.85 4565 9122 44.2 44.2 17.9% 0.0% 0.0% 0.0% 6.61sec 237889 299.65sec
base base solar_wrath 190984 852916 2846 18.97 7634 15251 94.2 94.7 18.0% 0.0% 0.0% 0.0% 3.12sec 852916 299.65sec
base base solar_empowerment 279729 493550 1647 14.98 6596 0 74.8 74.8 0.0% 0.0% 0.0% 0.0% 3.93sec 493550 299.65sec
base base starsurge 78674 3562638 11889 12.29 49253 98355 61.6 61.4 17.9% 0.0% 0.0% 0.0% 4.92sec 3562638 299.65sec
base base stellar_flare 202347 36524 122 2.56 2424 4841 12.8 12.8 18.0% 0.0% 0.0% 0.0% 23.57sec 477311 299.65sec
base base stellar_flare ticks -202347 440787 1469 43.87 1704 3406 12.8 219.3 17.9% 0.0% 0.0% 0.0% 23.57sec 477311 299.65sec
base base streaking_stars 272873 1736366 5795 18.02 16351 32707 90.0 90.0 18.0% 0.0% 0.0% 0.0% 3.10sec 1736366 299.65sec
base base sunfire 93402 82306 275 3.57 3913 7832 17.8 17.8 17.9% 0.0% 0.0% 0.0% 16.78sec 817891 299.65sec
base base sunfire ticks -93402 735586 2452 44.16 2825 5647 17.8 220.8 18.0% 0.0% 0.0% 0.0% 16.78sec 817891 299.65sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.53sec 0 299.65sec
blood of the enemy blood of the enemy blood_of_the_enemy 297108 108437 362 0.74 22903 57336 3.7 3.7 19.2% 0.0% 0.0% 0.0% 91.20sec 108437 299.65sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.72sec 0 299.65sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
blood of the enemy blood of the enemy heed_my_call 271685 92577 309 1.65 9107 18713 8.2 8.2 22.2% 0.0% 0.0% 0.0% 33.29sec 92577 299.65sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 39769 133 1.65 3903 8019 8.2 8.2 22.5% 0.0% 0.0% 0.0% 33.29sec 39769 299.65sec
blood of the enemy blood of the enemy lunar_strike 194153 1566208 5227 15.47 16497 33961 77.3 77.3 21.6% 0.0% 0.0% 0.0% 3.79sec 1566208 299.65sec
blood of the enemy blood of the enemy moonfire 8921 49351 165 2.81 2848 5920 14.0 14.0 21.7% 0.0% 0.0% 0.0% 21.41sec 779692 299.65sec
blood of the enemy blood of the enemy moonfire ticks -8921 730341 2434 44.75 2616 5514 14.0 223.7 22.4% 0.0% 0.0% 0.0% 21.41sec 779692 299.65sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
blood of the enemy blood of the enemy shooting_stars 202497 252948 844 8.95 4541 9552 44.7 44.7 22.3% 0.0% 0.0% 0.0% 6.54sec 252948 299.65sec
blood of the enemy blood of the enemy solar_wrath 190984 884621 2952 18.87 7587 15695 93.7 94.2 22.2% 0.0% 0.0% 0.0% 3.13sec 884621 299.65sec
blood of the enemy blood of the enemy solar_empowerment 279729 515201 1719 14.90 6924 0 74.4 74.4 0.0% 0.0% 0.0% 0.0% 3.93sec 515201 299.65sec
blood of the enemy blood of the enemy starsurge 78674 3757178 12539 12.25 48956 103812 61.4 61.2 22.7% 0.0% 0.0% 0.0% 4.92sec 3757178 299.65sec
blood of the enemy blood of the enemy stellar_flare 202347 38440 128 2.56 2409 5122 12.8 12.8 22.1% 0.0% 0.0% 0.0% 23.58sec 507074 299.65sec
blood of the enemy blood of the enemy stellar_flare ticks -202347 468634 1562 44.28 1696 3574 12.8 221.4 22.4% 0.0% 0.0% 0.0% 23.58sec 507074 299.65sec
blood of the enemy blood of the enemy streaking_stars 272873 1863541 6219 17.76 16354 34124 88.7 88.7 26.2% 0.0% 0.0% 0.0% 3.14sec 1863541 299.65sec
blood of the enemy blood of the enemy sunfire 93402 85239 284 3.57 3902 8038 17.8 17.8 21.2% 0.0% 0.0% 0.0% 16.76sec 865711 299.65sec
blood of the enemy blood of the enemy sunfire ticks -93402 780472 2602 44.58 2811 5908 17.8 222.9 22.3% 0.0% 0.0% 0.0% 16.76sec 865711 299.65sec
conflict+strife conflict+strife augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
conflict+strife conflict+strife berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.38sec 0 299.65sec
conflict+strife conflict+strife celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.35sec 0 299.65sec
conflict+strife conflict+strife flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
conflict+strife conflict+strife food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
conflict+strife conflict+strife heed_my_call 271685 90631 302 1.63 9451 18919 8.1 8.1 18.1% 0.0% 0.0% 0.0% 33.31sec 90631 299.65sec
conflict+strife conflict+strife heed_my_call_aoe 271686 38797 129 1.63 4051 8108 8.1 8.1 17.9% 0.0% 0.0% 0.0% 33.31sec 38797 299.65sec
conflict+strife conflict+strife lunar_strike 194153 1552360 5181 15.32 17224 34417 76.5 76.5 17.8% 0.0% 0.0% 0.0% 3.82sec 1552360 299.65sec
conflict+strife conflict+strife moonfire 8921 49154 164 2.81 2960 5925 14.1 14.1 18.1% 0.0% 0.0% 0.0% 21.32sec 759528 299.65sec
conflict+strife conflict+strife moonfire ticks -8921 710374 2368 44.17 2727 5450 14.1 220.9 18.0% 0.0% 0.0% 0.0% 21.32sec 759528 299.65sec
conflict+strife conflict+strife moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
conflict+strife conflict+strife potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
conflict+strife conflict+strife shooting_stars 202497 246357 822 8.82 4733 9461 44.1 44.1 18.1% 0.0% 0.0% 0.0% 6.63sec 246357 299.65sec
conflict+strife conflict+strife solar_wrath 190984 869571 2902 18.62 7923 15841 92.5 93.0 18.0% 0.0% 0.0% 0.0% 3.18sec 869571 299.65sec
conflict+strife conflict+strife solar_empowerment 279729 505570 1687 14.77 6855 0 73.8 73.8 0.0% 0.0% 0.0% 0.0% 3.97sec 505570 299.65sec
conflict+strife conflict+strife starsurge 78674 3653806 12194 12.14 51110 102177 60.8 60.6 17.9% 0.0% 0.0% 0.0% 4.96sec 3653806 299.65sec
conflict+strife conflict+strife stellar_flare 202347 37448 125 2.55 2493 4981 12.7 12.7 17.9% 0.0% 0.0% 0.0% 23.57sec 492856 299.65sec
conflict+strife conflict+strife stellar_flare ticks -202347 455407 1518 43.70 1768 3534 12.7 218.5 17.9% 0.0% 0.0% 0.0% 23.57sec 492856 299.65sec
conflict+strife conflict+strife streaking_stars 272873 1772885 5917 17.81 16901 33814 88.9 88.9 17.9% 0.0% 0.0% 0.0% 3.13sec 1772885 299.65sec
conflict+strife conflict+strife sunfire 93402 85002 284 3.56 4054 8121 17.8 17.8 18.0% 0.0% 0.0% 0.0% 16.79sec 844693 299.65sec
conflict+strife conflict+strife sunfire ticks -93402 759691 2532 44.00 2929 5855 17.8 220.0 17.9% 0.0% 0.0% 0.0% 16.79sec 844693 299.65sec
conflict+strife conflict+strife thorns 305497 785344 2621 8.01 16698 33389 45.0 40.0 17.6% 0.0% 0.0% 0.0% 4.47sec 785344 299.65sec
crucible of flame crucible of flame ancient_flame ticks -295367 375306 1251 17.95 3544 7085 24.9 89.8 18.0% 0.0% 0.0% 0.0% 11.81sec 375306 299.65sec
crucible of flame crucible of flame augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
crucible of flame crucible of flame berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.45sec 0 299.65sec
crucible of flame crucible of flame celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.50sec 0 299.65sec
crucible of flame crucible of flame concentrated_flame 295373 0 0 0.00 0 0 11.5 0.0 0.0% 0.0% 0.0% 0.0% 29.91sec 0 299.65sec
crucible of flame crucible of flame concentrated_flame_missile 295374 340605 1137 2.30 25144 50766 11.5 11.5 17.7% 0.0% 0.0% 0.0% 29.91sec 340605 299.65sec
crucible of flame crucible of flame concentrated_flame_burn ticks -295368 221878 740 6.40 6929 0 11.5 32.0 0.0% 0.0% 0.0% 0.0% 29.91sec 221878 299.65sec
crucible of flame crucible of flame flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
crucible of flame crucible of flame food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
crucible of flame crucible of flame heed_my_call 271685 87440 292 1.62 9106 18228 8.1 8.1 18.4% 0.0% 0.0% 0.0% 33.55sec 87440 299.65sec
crucible of flame crucible of flame heed_my_call_aoe 271686 37384 125 1.62 3903 7808 8.1 8.1 18.1% 0.0% 0.0% 0.0% 33.55sec 37384 299.65sec
crucible of flame crucible of flame lunar_strike 194153 1449127 4836 14.82 16597 33183 74.0 74.0 18.0% 0.0% 0.0% 0.0% 3.93sec 1449127 299.65sec
crucible of flame crucible of flame moonfire 8921 47190 157 2.82 2848 5702 14.1 14.1 17.8% 0.0% 0.0% 0.0% 21.27sec 727383 299.65sec
crucible of flame crucible of flame moonfire ticks -8921 680193 2267 43.93 2626 5248 14.1 219.6 18.0% 0.0% 0.0% 0.0% 21.27sec 727383 299.65sec
crucible of flame crucible of flame moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
crucible of flame crucible of flame potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
crucible of flame crucible of flame shooting_stars 202497 235504 786 8.77 4557 9110 43.8 43.8 18.1% 0.0% 0.0% 0.0% 6.64sec 235504 299.65sec
crucible of flame crucible of flame solar_wrath 190984 804934 2686 17.88 7646 15276 88.7 89.3 18.0% 0.0% 0.0% 0.0% 3.30sec 804934 299.65sec
crucible of flame crucible of flame solar_empowerment 279729 472463 1577 14.33 6602 0 71.6 71.6 0.0% 0.0% 0.0% 0.0% 4.07sec 472463 299.65sec
crucible of flame crucible of flame starsurge 78674 3423462 11425 11.82 49253 98440 59.2 59.0 17.8% 0.0% 0.0% 0.0% 5.08sec 3423462 299.65sec
crucible of flame crucible of flame stellar_flare 202347 35402 118 2.54 2368 4738 12.7 12.7 17.8% 0.0% 0.0% 0.0% 23.58sec 471408 299.65sec
crucible of flame crucible of flame stellar_flare ticks -202347 436006 1453 43.45 1702 3403 12.7 217.3 17.9% 0.0% 0.0% 0.0% 23.58sec 471408 299.65sec
crucible of flame crucible of flame streaking_stars 272873 1652095 5513 17.17 16357 32722 85.7 85.7 17.8% 0.0% 0.0% 0.0% 3.24sec 1652095 299.65sec
crucible of flame crucible of flame sunfire 93402 81410 272 3.54 3905 7807 17.7 17.7 17.9% 0.0% 0.0% 0.0% 16.80sec 808885 299.65sec
crucible of flame crucible of flame sunfire ticks -93402 727475 2425 43.75 2821 5638 17.7 218.8 17.9% 0.0% 0.0% 0.0% 16.80sec 808885 299.65sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.62sec 0 299.65sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.43sec 0 299.65sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
focusing iris focusing iris heed_my_call 271685 91606 306 1.71 9107 18217 8.5 8.5 18.1% 0.0% 0.0% 0.0% 32.28sec 91606 299.65sec
focusing iris focusing iris heed_my_call_aoe 271686 39261 131 1.71 3903 7805 8.5 8.5 18.1% 0.0% 0.0% 0.0% 32.28sec 39261 299.65sec
focusing iris focusing iris lunar_strike 194153 1578542 5268 16.15 16589 33167 80.7 80.7 18.0% 0.0% 0.0% 0.0% 3.63sec 1578542 299.65sec
focusing iris focusing iris moonfire 8921 47632 159 2.83 2855 5715 14.1 14.1 17.9% 0.0% 0.0% 0.0% 21.35sec 763531 299.65sec
focusing iris focusing iris moonfire ticks -8921 715899 2386 46.13 2633 5261 14.1 230.6 17.9% 0.0% 0.0% 0.0% 21.35sec 763531 299.65sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
focusing iris focusing iris shooting_stars 202497 248357 829 9.23 4568 9125 46.1 46.1 18.0% 0.0% 0.0% 0.0% 6.34sec 248357 299.65sec
focusing iris focusing iris solar_wrath 190984 901075 3007 20.02 7643 15275 99.5 100.0 17.9% 0.0% 0.0% 0.0% 2.96sec 901075 299.65sec
focusing iris focusing iris solar_empowerment 279729 512508 1710 15.54 6605 0 77.6 77.6 0.0% 0.0% 0.0% 0.0% 3.77sec 512508 299.65sec
focusing iris focusing iris starsurge 78674 3692615 12323 12.72 49286 98493 63.8 63.5 17.9% 0.0% 0.0% 0.0% 4.74sec 3692615 299.65sec
focusing iris focusing iris stellar_flare 202347 36593 122 2.56 2428 4861 12.8 12.8 17.8% 0.0% 0.0% 0.0% 23.56sec 496070 299.65sec
focusing iris focusing iris stellar_flare ticks -202347 459477 1532 45.66 1706 3410 12.8 228.3 18.0% 0.0% 0.0% 0.0% 23.56sec 496070 299.65sec
focusing iris focusing iris streaking_stars 272873 1802899 6017 18.74 16351 32707 93.6 93.6 17.8% 0.0% 0.0% 0.0% 3.01sec 1802899 299.65sec
focusing iris focusing iris sunfire 93402 80988 270 3.51 3913 7828 17.5 17.5 18.0% 0.0% 0.0% 0.0% 17.08sec 847472 299.65sec
focusing iris focusing iris sunfire ticks -93402 766484 2555 45.97 2828 5653 17.5 229.9 17.9% 0.0% 0.0% 0.0% 17.08sec 847472 299.65sec
life-force life-force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
life-force life-force azerite_spike 295835 222798 744 3.39 11151 22309 17.0 16.9 18.0% 0.0% 0.0% 0.0% 17.14sec 222798 299.65sec
life-force life-force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.55sec 0 299.65sec
life-force life-force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.46sec 0 299.65sec
life-force life-force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
life-force life-force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
life-force life-force guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
life-force life-force heed_my_call 271685 91753 306 1.67 9323 18655 8.3 8.3 18.2% 0.0% 0.0% 0.0% 32.92sec 91753 299.65sec
life-force life-force heed_my_call_aoe 271686 39268 131 1.67 3996 7986 8.3 8.3 18.0% 0.0% 0.0% 0.0% 32.92sec 39268 299.65sec
life-force life-force lunar_strike 194153 1561754 5212 15.61 16994 33974 77.9 77.9 17.9% 0.0% 0.0% 0.0% 3.75sec 1561754 299.65sec
life-force life-force moonfire 8921 48173 161 2.81 2918 5839 14.0 14.0 17.8% 0.0% 0.0% 0.0% 21.38sec 769125 299.65sec
life-force life-force moonfire ticks -8921 720952 2403 45.17 2706 5407 14.0 225.9 18.0% 0.0% 0.0% 0.0% 21.38sec 769125 299.65sec
life-force life-force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
life-force life-force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
life-force life-force shooting_stars 202497 249562 833 9.02 4696 9387 45.0 45.0 18.0% 0.0% 0.0% 0.0% 6.49sec 249562 299.65sec
life-force life-force solar_wrath 190984 883480 2948 19.11 7851 15688 94.9 95.4 18.0% 0.0% 0.0% 0.0% 3.09sec 883480 299.65sec
life-force life-force solar_empowerment 279729 509111 1699 15.04 6778 0 75.1 75.1 0.0% 0.0% 0.0% 0.0% 3.89sec 509111 299.65sec
life-force life-force starsurge 78674 3674822 12264 12.35 50527 101040 61.9 61.7 18.0% 0.0% 0.0% 0.0% 4.87sec 3674822 299.65sec
life-force life-force stellar_flare 202347 37303 124 2.55 2487 4977 12.7 12.7 17.7% 0.0% 0.0% 0.0% 23.57sec 498958 299.65sec
life-force life-force stellar_flare ticks -202347 461656 1539 44.69 1753 3503 12.7 223.4 17.9% 0.0% 0.0% 0.0% 23.57sec 498958 299.65sec
life-force life-force streaking_stars 272873 1848787 6170 18.52 16956 33912 92.5 92.5 17.9% 0.0% 0.0% 0.0% 3.01sec 1848787 299.65sec
life-force life-force sunfire 93402 85016 284 3.59 4023 8054 17.9 17.9 17.9% 0.0% 0.0% 0.0% 16.62sec 856165 299.65sec
life-force life-force sunfire ticks -93402 771149 2570 45.00 2906 5806 17.9 225.0 18.0% 0.0% 0.0% 0.0% 16.62sec 856165 299.65sec
life-force life-force_guardian_of_azeroth azerite_spike 295856 474146 7902 58.21 6927 13853 58.2 58.2 17.6% 0.0% 0.0% 0.0% 3.64sec 474146 60.00sec
life-force life-force_guardian_of_azeroth azerite_volley 303351 61040 1017 6.00 8658 17316 6.0 6.0 17.5% 0.0% 0.0% 0.0% 39.27sec 61040 60.00sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.03sec 0 299.65sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.09sec 0 299.65sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
lucid dreams lucid dreams heed_my_call 271685 88598 296 1.64 9203 18380 8.2 8.2 17.9% 0.0% 0.0% 0.0% 33.03sec 88598 299.65sec
lucid dreams lucid dreams heed_my_call_aoe 271686 37993 127 1.64 3943 7882 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.03sec 37993 299.65sec
lucid dreams lucid dreams lunar_strike 194153 1504894 5022 15.26 16746 33480 76.2 76.2 18.0% 0.0% 0.0% 0.0% 3.83sec 1504894 299.65sec
lucid dreams lucid dreams memory_of_lucid_dreams 298357 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.10sec 0 299.65sec
lucid dreams lucid dreams moonfire 8921 47677 159 2.84 2859 5717 14.2 14.2 17.8% 0.0% 0.0% 0.0% 21.26sec 746644 299.65sec
lucid dreams lucid dreams moonfire ticks -8921 698967 2330 44.45 2667 5330 14.2 222.2 18.0% 0.0% 0.0% 0.0% 21.26sec 746644 299.65sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
lucid dreams lucid dreams shooting_stars 202497 242261 808 8.89 4626 9243 44.4 44.4 18.0% 0.0% 0.0% 0.0% 6.57sec 242261 299.65sec
lucid dreams lucid dreams solar_wrath 190984 775729 2589 16.98 7757 15513 84.1 84.8 17.9% 0.0% 0.0% 0.0% 3.48sec 775729 299.65sec
lucid dreams lucid dreams solar_empowerment 279729 536636 1791 16.05 6696 0 80.1 80.1 0.0% 0.0% 0.0% 0.0% 3.64sec 536636 299.65sec
lucid dreams lucid dreams starsurge 78674 4230831 14119 14.38 49984 99907 72.1 71.8 17.9% 0.0% 0.0% 0.0% 4.20sec 4230831 299.65sec
lucid dreams lucid dreams stellar_flare 202347 36737 123 2.56 2445 4895 12.8 12.8 17.6% 0.0% 0.0% 0.0% 23.58sec 485376 299.65sec
lucid dreams lucid dreams stellar_flare ticks -202347 448639 1495 44.01 1729 3455 12.8 220.0 18.0% 0.0% 0.0% 0.0% 23.58sec 485376 299.65sec
lucid dreams lucid dreams streaking_stars 272873 1889596 6306 19.37 16564 33121 96.7 96.7 17.9% 0.0% 0.0% 0.0% 2.91sec 1889596 299.65sec
lucid dreams lucid dreams sunfire 93402 81502 272 3.49 3970 7938 17.4 17.4 17.8% 0.0% 0.0% 0.0% 17.17sec 828853 299.65sec
lucid dreams lucid dreams sunfire ticks -93402 747351 2491 44.28 2862 5722 17.4 221.4 17.9% 0.0% 0.0% 0.0% 17.17sec 828853 299.65sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.40sec 0 299.65sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.12sec 0 299.65sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
purification protocol purification protocol heed_my_call 271685 87366 292 1.64 9111 18220 8.2 8.2 17.4% 0.0% 0.0% 0.0% 33.47sec 87366 299.65sec
purification protocol purification protocol heed_my_call_aoe 271686 37613 126 1.64 3905 7811 8.2 8.2 17.9% 0.0% 0.0% 0.0% 33.47sec 37613 299.65sec
purification protocol purification protocol lunar_strike 194153 1486503 4961 15.21 16593 33179 75.9 75.9 18.0% 0.0% 0.0% 0.0% 3.85sec 1486503 299.65sec
purification protocol purification protocol moonfire 8921 47355 158 2.82 2855 5712 14.1 14.1 18.0% 0.0% 0.0% 0.0% 21.33sec 730728 299.65sec
purification protocol purification protocol moonfire ticks -8921 683373 2278 44.12 2628 5252 14.1 220.6 17.9% 0.0% 0.0% 0.0% 21.33sec 730728 299.65sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
purification protocol purification protocol purification_protocol 295293 180854 604 3.30 9295 18593 16.5 16.5 18.1% 0.0% 0.0% 0.0% 17.42sec 180854 299.65sec
purification protocol purification protocol purifying_blast 295337 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.36sec 0 299.65sec
purification protocol purification protocol purifying_tick ticks -295338 202211 674 0.00 4533 9071 37.9 0.0 17.6% 0.0% 0.0% 0.0% 7.63sec 202211 299.65sec
purification protocol purification protocol shooting_stars 202497 236660 790 8.81 4559 9113 44.0 44.0 18.0% 0.0% 0.0% 0.0% 6.61sec 236660 299.65sec
purification protocol purification protocol solar_wrath 190984 828182 2764 18.40 7642 15277 91.4 91.9 18.0% 0.0% 0.0% 0.0% 3.21sec 828182 299.65sec
purification protocol purification protocol solar_empowerment 279729 482971 1612 14.65 6599 0 73.2 73.2 0.0% 0.0% 0.0% 0.0% 3.99sec 482971 299.65sec
purification protocol purification protocol starsurge 78674 3501004 11684 12.06 49255 98443 60.4 60.2 18.1% 0.0% 0.0% 0.0% 4.99sec 3501004 299.65sec
purification protocol purification protocol stellar_flare 202347 35984 120 2.55 2396 4791 12.7 12.7 17.9% 0.0% 0.0% 0.0% 23.57sec 474290 299.65sec
purification protocol purification protocol stellar_flare ticks -202347 438306 1461 43.65 1703 3404 12.7 218.2 17.9% 0.0% 0.0% 0.0% 23.57sec 474290 299.65sec
purification protocol purification protocol streaking_stars 272873 1707943 5700 17.75 16350 32702 88.7 88.7 17.8% 0.0% 0.0% 0.0% 3.13sec 1707943 299.65sec
purification protocol purification protocol sunfire 93402 82720 276 3.59 3914 7833 17.9 17.9 17.9% 0.0% 0.0% 0.0% 16.63sec 813907 299.65sec
purification protocol purification protocol sunfire ticks -93402 731188 2437 43.94 2823 5641 17.9 219.7 17.9% 0.0% 0.0% 0.0% 16.63sec 813907 299.65sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.43sec 0 299.65sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.16sec 0 299.65sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
ripple in space ripple in space heed_my_call 271685 87403 292 1.63 9106 18226 8.1 8.1 18.2% 0.0% 0.0% 0.0% 33.41sec 87403 299.65sec
ripple in space ripple in space heed_my_call_aoe 271686 37517 125 1.63 3903 7803 8.1 8.1 18.4% 0.0% 0.0% 0.0% 33.41sec 37517 299.65sec
ripple in space ripple in space lunar_strike 194153 1550105 5173 15.22 17279 34518 76.0 76.0 18.0% 0.0% 0.0% 0.0% 3.84sec 1550105 299.65sec
ripple in space ripple in space moonfire 8921 49408 165 2.82 2982 5961 14.1 14.1 17.8% 0.0% 0.0% 0.0% 21.31sec 761433 299.65sec
ripple in space ripple in space moonfire ticks -8921 712025 2373 44.12 2738 5469 14.1 220.6 17.9% 0.0% 0.0% 0.0% 21.31sec 761433 299.65sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
ripple in space ripple in space ripple_in_space 302731 103873 347 1.09 19122 0 5.5 5.4 0.0% 0.0% 0.0% 0.0% 60.37sec 103873 299.65sec
ripple in space ripple in space shooting_stars 202497 246824 824 8.82 4751 9505 44.0 44.0 17.9% 0.0% 0.0% 0.0% 6.61sec 246824 299.65sec
ripple in space ripple in space solar_wrath 190984 861835 2876 18.38 7963 15916 91.3 91.8 17.9% 0.0% 0.0% 0.0% 3.22sec 861835 299.65sec
ripple in space ripple in space solar_empowerment 279729 503144 1679 14.66 6870 0 73.2 73.2 0.0% 0.0% 0.0% 0.0% 3.98sec 503144 299.65sec
ripple in space ripple in space starsurge 78674 3627142 12105 12.06 51106 102045 60.4 60.2 17.9% 0.0% 0.0% 0.0% 4.99sec 3627142 299.65sec
ripple in space ripple in space stellar_flare 202347 37387 125 2.55 2492 4984 12.7 12.7 17.8% 0.0% 0.0% 0.0% 23.57sec 494097 299.65sec
ripple in space ripple in space stellar_flare ticks -202347 456710 1522 43.65 1774 3545 12.7 218.3 18.0% 0.0% 0.0% 0.0% 23.57sec 494097 299.65sec
ripple in space ripple in space streaking_stars 272873 1711427 5711 17.76 16354 32716 88.7 88.7 17.9% 0.0% 0.0% 0.0% 3.13sec 1711427 299.65sec
ripple in space ripple in space sunfire 93402 86368 288 3.59 4081 8156 17.9 17.9 18.1% 0.0% 0.0% 0.0% 16.60sec 848464 299.65sec
ripple in space ripple in space sunfire ticks -93402 762096 2540 43.95 2940 5874 17.9 219.8 18.0% 0.0% 0.0% 0.0% 16.60sec 848464 299.65sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.37sec 0 299.65sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.09sec 0 299.65sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
unbound force unbound force heed_my_call 271685 90656 303 1.63 9107 18222 8.2 8.2 22.1% 0.0% 0.0% 0.0% 33.38sec 90656 299.65sec
unbound force unbound force heed_my_call_aoe 271686 38822 130 1.63 3903 7807 8.2 8.2 22.0% 0.0% 0.0% 0.0% 33.38sec 38822 299.65sec
unbound force unbound force lunar_strike 194153 1518029 5066 15.24 16589 33101 76.1 76.1 20.4% 0.0% 0.0% 0.0% 3.84sec 1518029 299.65sec
unbound force unbound force moonfire 8921 48814 163 2.82 2856 5691 14.1 14.1 21.7% 0.0% 0.0% 0.0% 21.33sec 753437 299.65sec
unbound force unbound force moonfire ticks -8921 704623 2349 44.13 2631 5239 14.1 220.6 21.6% 0.0% 0.0% 0.0% 21.33sec 753437 299.65sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
unbound force unbound force shooting_stars 202497 245156 818 8.83 4564 9090 44.1 44.1 22.0% 0.0% 0.0% 0.0% 6.61sec 245156 299.65sec
unbound force unbound force solar_wrath 190984 847872 2830 18.48 7640 15251 91.7 92.3 20.3% 0.0% 0.0% 0.0% 3.20sec 847872 299.65sec
unbound force unbound force solar_empowerment 279729 493648 1647 14.68 6732 0 73.3 73.3 0.0% 0.0% 0.0% 0.0% 3.99sec 493648 299.65sec
unbound force unbound force starsurge 78674 3589776 11980 12.08 49280 98161 60.5 60.3 20.9% 0.0% 0.0% 0.0% 4.98sec 3589776 299.65sec
unbound force unbound force stellar_flare 202347 36916 123 2.55 2400 4792 12.7 12.7 20.8% 0.0% 0.0% 0.0% 23.58sec 488276 299.65sec
unbound force unbound force stellar_flare ticks -202347 451360 1505 43.66 1705 3397 12.7 218.3 21.5% 0.0% 0.0% 0.0% 23.58sec 488276 299.65sec
unbound force unbound force streaking_stars 272873 1730594 5775 17.66 16353 32709 88.2 88.2 20.0% 0.0% 0.0% 0.0% 3.15sec 1730594 299.65sec
unbound force unbound force sunfire 93402 85413 285 3.60 3919 7804 18.0 18.0 21.5% 0.0% 0.0% 0.0% 16.58sec 838601 299.65sec
unbound force unbound force sunfire ticks -93402 753188 2511 43.96 2825 5627 18.0 219.8 21.5% 0.0% 0.0% 0.0% 16.58sec 838601 299.65sec
unbound force unbound force the_unbound_force ticks -298452 333985 1113 7.92 1322 6799 5.0 39.6 76.4% 0.0% 0.0% 0.0% 67.22sec 333985 299.65sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.26sec 0 299.65sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 154.63sec 0 299.65sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
visions visions heed_my_call 271685 89872 300 1.66 9198 18384 8.3 8.3 18.1% 0.0% 0.0% 0.0% 33.34sec 89872 299.65sec
visions visions heed_my_call_aoe 271686 38477 128 1.66 3942 7881 8.3 8.3 18.0% 0.0% 0.0% 0.0% 33.34sec 38477 299.65sec
visions visions lunar_strike 194153 1583572 5285 15.80 17007 33993 78.9 78.9 18.0% 0.0% 0.0% 0.0% 3.71sec 1583572 299.65sec
visions visions moonfire 8921 48866 163 2.85 2908 5815 14.3 14.3 17.9% 0.0% 0.0% 0.0% 21.22sec 768012 299.65sec
visions visions moonfire ticks -8921 719147 2397 45.10 2706 5407 14.3 225.5 17.9% 0.0% 0.0% 0.0% 21.22sec 768012 299.65sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
visions visions shooting_stars 202497 249735 833 9.02 4696 9391 45.1 45.1 18.0% 0.0% 0.0% 0.0% 6.51sec 249735 299.65sec
visions visions solar_wrath 190984 882173 2944 19.00 7886 15756 94.3 94.9 17.9% 0.0% 0.0% 0.0% 3.12sec 882173 299.65sec
visions visions solar_empowerment 279729 526989 1759 15.51 6803 0 77.5 77.5 0.0% 0.0% 0.0% 0.0% 3.79sec 526989 299.65sec
visions visions starsurge 78674 3819080 12745 12.79 50722 101359 64.1 63.9 18.0% 0.0% 0.0% 0.0% 4.72sec 3819080 299.65sec
visions visions stellar_flare 202347 37321 125 2.56 2475 4949 12.8 12.8 18.0% 0.0% 0.0% 0.0% 23.57sec 498551 299.65sec
visions visions stellar_flare ticks -202347 461231 1537 44.62 1753 3504 12.8 223.1 17.9% 0.0% 0.0% 0.0% 23.57sec 498551 299.65sec
visions visions streaking_stars 272873 2553401 8521 26.26 16517 33030 131.1 131.1 17.9% 0.0% 0.0% 0.0% 2.20sec 2553401 299.65sec
visions visions sunfire 93402 85324 285 3.60 4019 8046 18.0 18.0 18.0% 0.0% 0.0% 0.0% 16.68sec 854989 299.65sec
visions visions sunfire ticks -93402 769665 2566 44.92 2906 5810 18.0 224.6 17.9% 0.0% 0.0% 0.0% 16.68sec 854989 299.65sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.42sec 0 299.65sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.14sec 0 299.65sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
worldvein worldvein heed_my_call 271685 87821 293 1.64 9107 18218 8.2 8.2 17.9% 0.0% 0.0% 0.0% 33.11sec 87821 299.65sec
worldvein worldvein heed_my_call_aoe 271686 37764 126 1.64 3904 7803 8.2 8.2 18.3% 0.0% 0.0% 0.0% 33.11sec 37764 299.65sec
worldvein worldvein lunar_strike 194153 1595720 5325 15.22 17794 35586 76.0 76.0 18.0% 0.0% 0.0% 0.0% 3.84sec 1595720 299.65sec
worldvein worldvein moonfire 8921 50718 169 2.82 3058 6114 14.1 14.1 18.0% 0.0% 0.0% 0.0% 21.31sec 783833 299.65sec
worldvein worldvein moonfire ticks -8921 733115 2444 44.12 2818 5632 14.1 220.6 17.9% 0.0% 0.0% 0.0% 21.31sec 783833 299.65sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.65sec
worldvein worldvein shooting_stars 202497 254027 848 8.82 4888 9769 44.1 44.1 18.0% 0.0% 0.0% 0.0% 6.64sec 254027 299.65sec
worldvein worldvein solar_wrath 190984 886306 2958 18.39 8189 16366 91.3 91.9 17.8% 0.0% 0.0% 0.0% 3.22sec 886306 299.65sec
worldvein worldvein solar_empowerment 279729 518171 1729 14.68 7069 0 73.3 73.3 0.0% 0.0% 0.0% 0.0% 3.99sec 518171 299.65sec
worldvein worldvein starsurge 78674 3728953 12444 12.06 52480 104853 60.4 60.2 18.0% 0.0% 0.0% 0.0% 4.99sec 3728953 299.65sec
worldvein worldvein stellar_flare 202347 38566 129 2.55 2567 5132 12.7 12.7 18.0% 0.0% 0.0% 0.0% 23.57sec 508529 299.65sec
worldvein worldvein stellar_flare ticks -202347 469963 1567 43.65 1826 3651 12.7 218.3 17.9% 0.0% 0.0% 0.0% 23.57sec 508529 299.65sec
worldvein worldvein streaking_stars 272873 1709678 5706 17.76 16352 32708 88.7 88.7 17.9% 0.0% 0.0% 0.0% 3.13sec 1709678 299.65sec
worldvein worldvein sunfire 93402 88579 296 3.59 4194 8391 17.9 17.9 17.8% 0.0% 0.0% 0.0% 16.59sec 872954 299.65sec
worldvein worldvein sunfire ticks -93402 784375 2615 43.95 3027 6049 17.9 219.8 18.0% 0.0% 0.0% 0.0% 16.59sec 872954 299.65sec
worldvein worldvein worldvein_resonance 295186 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.36sec 0 299.65sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
417712.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 14.03% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:14.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.57% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.29% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.09% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.51% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.93% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.93%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.21% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.21%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.73% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.01% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.01%

Trigger Attempt Success

  • trigger_pct:100.00%
Blood of the Enemy 2.0 0.0 182.9sec 182.9sec 6.77% 9.11% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_blood_of_the_enemy
  • max_stacks:1
  • duration:10.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_of_the_enemy_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297108
  • name:Blood of the Enemy
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing $s1 Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 10.8 64.3 28.5sec 3.8sec 44.01% 0.00% 64.3(64.3) 10.5

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:44.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 417712.22
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7592
Mean 299.65
Minimum 240.05
Maximum 360.00
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7592
Mean 448224.74
Minimum 425551.84
Maximum 475125.95
Spread ( max - min ) 49574.11
Range [ ( max - min ) / 2 * 100% ] 5.53%
Standard Deviation 9347.5178
5th Percentile 433903.91
95th Percentile 463087.53
( 95th Percentile - 5th Percentile ) 29183.62
Mean Distribution
Standard Deviation 107.2799
95.00% Confidence Intervall ( 448014.48 - 448435.00 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1671
0.1 Scale Factor Error with Delta=300 745893
0.05 Scale Factor Error with Delta=300 2983571
0.01 Scale Factor Error with Delta=300 74589255
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7592
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1591
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 113229951 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n